Санкт-Петербургский Государственный Университет Кафедра

Доступен только на StudyGur

Тема:
Скачиваний: 160
Страниц: 123
Опубликован:
ЧИТАЙТЕ ПОЛНЫЙ ТЕКСТ ДОКУМЕНТА

ПРЕДПРОСМОТР

Санкт-Петербургский Государственный Университет
Кафедра микробиологии
На правах рукописи
МИНАЕВА ЕКАТЕРИНА СЕРГЕЕВНА
СТРУКТУРА И ФУНКЦИИ СИГНАЛЬНЫХ БЕЛКОВ PII
У ОДНОКЛЕТОЧНЫХ ЗЕЛЕНЫХ ВОДОРОСЛЕЙ
CHLAMYDOMONAS REINHARDTII И CHLORELLA VARIABILIS
03.02.03 – микробиология
Диссертация на соискание ученой степени
кандидата биологических наук
Научный руководитель:
д.б.н., проф. Е. В. Ермилова
Санкт-Петербург
2016
2
СОДЕРЖАНИЕ
ВВЕДЕНИЕ…………….….……………………………………………………………4
ГЛАВА 1. ОБЗОР ЛИТЕРАТУРЫ…………………………………………………...8
1.1. Распространенность белков PII в природе………………………………….....8
1.2. PII бактерий……………………………………………………………………...9
1.2.1. Грамотрицательные бактерии……………………………………………..9
1.2.2. Грамположительные бактерии…………………………………………...23
1.3. PII архей………………………………………………………………………..28
1.4. PII эукариот……………………………………………………………………30
ГЛАВА 2. МАТЕРИАЛЫ И МЕТОДЫ……………………………………………...38
2.1. Объекты исследования и условия культивирования………………………38
2.2. Получение прегамет и гамет Chlamydomonas reinhardtii………………….39
2.3. Определение концентрации хлорофилла…………………………………...39
2.4. Выделение тотальной РНК…………………………………………………..40
2.5. Метод ПЦР, OT-ПЦР и ПЦР в режиме реального времени……………….40
2.6. Клонирование и секвенирование ДНК-фрагментов……………...………..43
2.7. Выделение тотального белка и определение его концентрации…………44
2.8. Вестерн-блоттинг…………………………………………………………….44
2.9. Изоляция хлоропластов из клеток Chlamydomonas reinhardtii……………45
2.10. Определение активности глутаминсинтетазы (GS)………………………..46
2.11. Определение внутриклеточного содержания свободного аргинина ……..46
2.12. Определение содержания глутамата в среде……………………………….47
2.13. Клонирование, экспрессия и очистка рекомбинантных белков…………..47
2.14. Гель-фильтрация……………………………………………………………..49
2.15. Метод оценки активности фермента NAGK……………………………….50
ГЛАВА 3. РЕЗУЛЬТАТЫ..…………………………………………...………………52
3.1. Характеристика белка PII Chlamydomonas reinhardtii (CrPII)……………...52
3.1.1. Биоинформационный анализ первичной последовательности CrPII….52
3.1.2. Иммунологическая идентификация CrPII………………………………54
3.1.3. Транскрипция гена CrGLB1, кодирующего белок CrPII……………….55
3
3.1.4. Олигомерная структура CrPII……………………………………………59
3.2. Идентификация и характеристика белка PII Chlorella variabilis (CvPII)…..60
3.2.1. Биоинформационный анализ первичной последовательности CvPII….60
3.2.2. Иммунологическая идентификация CvPII………………………………63
3.2.3. Определение последовательности кодирующей цепи ДНК CvPII….....64
3.2.4. Транскрипция гена CvGLB1, кодирующего белок CvPII………………67
3.2.5. Олигомерная структура CvPII……………………………………………73
3.3.
Характеристика
N-ацетил-L-глутаматкиназ
(NAGK)
C.reinhardtii
и
C.variabilis…………………………………………………………………………..74
3.3.1.
Биоинформационный
анализ
первичных
последовательностей
CvNAGK и CrNAGK…………………………………………………………….74
3.3.2. Олигомерная структура CvNAGK и CrNAGK………………………….77
3.4. Взаимодействие PII-белков с N-ацетил-L-глутаматкиназами……………...78
3.4.1. Формирование комплексов PII-NAGK…………………………………..78
3.4.2. Действие PII на активность NAGK………………………………………79
3.4.2.1. Глутамин-зависимая регуляция белками PII активности NAGK
одноклеточных зеленых водорослей………………………………………...79
3.4.2.2. Глутамин-зависимая регуляция белками PII активности NAGK
растений……………………………………………………………………….90
ГЛАВА 4. ОБСУЖДЕНИЕ РЕЗУЛЬТАТОВ………………………………..……....93
4.1. Структура и регуляция белков PII Chlamydomonas reinhardtii и Chlorella
variabilis……………………………………………………………………………..93
4.2. N-ацетил-L-глутаматкиназы – мишени белков PII фотосинтезирующих
организмов………………………………………………………………………….96
ЗАКЛЮЧЕНИЕ………………………………………………………………………101
ВЫВОДЫ…………………………………………………………………………….104
БЛАГОДАРНОСТИ………………………………………………………………….105
СПИСОК СОКРАЩЕНИЙ……………………………………………….…………106
СПИСОК ЛИТЕРАТУРЫ…………………………………………………………...108
4
ВВЕДЕНИЕ
Актуальность темы. Одно из фундаментальных свойств микроорганизмов
состоит в их способности быстро адаптироваться к изменениям в окружающей
среде, что обеспечивается в значительной степени эффективной работой систем
рецепции, передачи и интеграции экзо- и эндогенных сигналов. У прокариот
(бактерий и архей) особая роль в рецепции и передаче различных по природе
сигналов принадлежит двухкомпонентным регуляторным системам, вовлеченным
в регуляцию метаболизма при изменяющихся условиях среды (Ермилова, 2012).
Наряду с двухкомпонентными регуляторными системами ключевые функции в
координированной регуляции центральных метаболических процессов у бактерий
выполняют сигнальные белки семейства PII (Forchhammer, 2008). Сигналы об
уровнях углерода, азота и энергетическом статусе бактериальных клеток
преобразуются в различные конформационные состояния и модификации этих
белков (Commichau et al., 2006). В зависимости от конформационного состояния
белки PII взаимодействуют с разными белками-мишенями, большинство из
которых выполняют или регулируют ключевые реакции в путях ассимиляции
азота (Ермилова, 2012). Последние данные указывают на то, что PII-трансдукторы
могут представлять одно из наиболее распространенных семейств сигнальных
белков в природе (Sant’Anna et al., 2009). Учитывая их присутствие у архей,
бактерий и высших растений, PII-белки представляют древнюю сигнальную
систему, которая сохранила консервативность в процессе эволюции для
координации реакций ассимиляции азота в ответ на состояние метаболизма.
Анализ структуры и функций PII-белков способствует решению фундаментальной
проблемы биологии, связанной с выяснением механизмов, определяющих у
разных по уровню организации организмов восприятие и реализацию клетками
специфических
ответов
на
действующие
сигналы,
включая
такие
как
присутствие/отсутствие в среде тех или иных питательных субстратов.
До
начала
охарактеризован
наших
ни
исследований
один
(Ermilova
представитель
белков
et
из
al.,
2013)
семейства
не
был
PII
у
эукариотических микроорганизмов. Последнее обстоятельство значительно
5
ограничивало существовавшие представления как о свойствах самих белков, так и
о спектре процессов, относящихся к метаболизму азота, которые они
контролируют у организмов в целом.
Цель работы состояла в характеристике структуры и функций сигнальных
белков из семейства РII у модельных представителей одноклеточных зеленых
водорослей Chlamydomonas reinhardtii и Chlorella variabilis.
В
связи
с
этим
были
сформулированы
следующие
задачи
исследования:
1. Провести биоинформационный анализ первичных последовательностей
белков PII C. reinhardtii и C. variabilis, определить их олигомерную структуру и
субклеточную локализацию.
2. С помощью метода ПЦР в режиме реального времени провести анализ
транскрипции генов CrGLB1 и CvGLB1 в разных условиях роста C. reinhardtii и C.
variabilis.
3. Оценить возможность формирования комплексов PII-белков C. reinhardtii
(CrPII) и C. variabilis (CvPII) с N-ацетил-L-глутаматкиназами (NAGK) и
проанализировать роль CrPII и CvPII в регуляции активности соответствующих
NAGK.
4. Провести сравнительный анализ особенностей PII-контролируемой
регуляции N-ацетил-L-глутаматкиназ C. reinhardtii, C. variabilis и двух
филогенетически удаленных представителей высших растений – Physcomitrella
patens и Oryza sativa.
Научная
новизна
исследования.
Впервые
для
представителей
фотосинтезирующих эукариотических микроорганизмов, C. reinhardtii и C.
variabilis, выявлены и охарактеризованы белки из консервативного семейства
сигнальных белков PII. Показано, что зрелые белки CrPII и CvPII локализованы в
хлоропластах и, как белки прокариот и высших растений, формируют
гомотримеры. Нерешенным вопросом эволюции PII-белков эукариот, включая
проанализированные нами белки одноклеточных зеленых водорослей, было
появление в их структуре удлиненного С-конца, функциональное значение
6
которого было неясно. Нами впервые показано, что дополнительный участок на
С-конце, обозначенный нами как Q-петля, специфичен для эукариотических PIIбелков и формирует сайт для связывания глутамина. Установлено, что
взаимодействие с глутамином индуцирует такую конформацию PII, в которой
белок может связывать и активировать ключевой фермент метаболизма азота, Nацетил-L-глутаматкиназу, обеспечивая тем самым контрольный механизм
формирования орнитина, аргинина и запасания азота в целом.
Теоретическая и практическая значимость. Нами выявлен механизм
восприятия глутамина в хлоропластах зеленых водорослей и высших растений за
исключением представителей сем. Brassicaceae. Выявление первого рецептора
глутамина в хлоропластах открывает дополнительные перспективы для более
глубокого понимания метаболизма азота у фотосинтезирующих организмов.
Нами впервые предложен референс-ген для Chlorella variabilis, что делает
возможным проведение корректного анализа количественной экспрессии генов у
данного микроорганизма.
Полученные в работе генетические конструкции могут быть использованы
на практике широким кругом исследователей при работе с РII-регулируемыми
системами фотосинтезирующих эукариот.
Результаты, полученные в ходе выполнения проекта, могут быть
использованы в материалах курсов лекций, читаемых на биологическом
факультете СПбГУ («Экология микроорганизмов», «Регуляторные процессы у
бактерий»,
«Сигнальные
системы
растений»,
«Физиология
растительной
клетки»).
Основные положения, выносимые на защиту:
1. Одноклеточные зеленые водоросли Chlamydomonas reinhardtii и Chlorella
variabilis имеют сигнальные белки из семейства PII, которые принадлежат к
субсемейству GlnB.
2. PII-белки C. reinhardtii и C. variabilis локализованы в хлоропластах, формируют
гомотримеры и контролируют фермент N-ацетил-L-глутаматкиназу (NAGK),
который регулирует синтез аргинина.
7
3. PII-белки C. reinhardtii и C. variabilis содержат дополнительный участок на Сконце, Q-петлю, с помощью которой связывают глутамин и регулируют
активность NAGK по глутамин-зависимому механизму.
Апробация работы. Материалы диссертации доложены и обсуждены на
VII Съезде Общества физиологов растений России «Физиология растений –
фундаментальная основа экологии и инновационных биотехнологий» (Нижний
Новгород, 2011),
молекулярной
Всероссийской
на XV международной конференции по клеточной и
биологии
научной
Chlamydomonas
(Потсдам,
конференции
с
Германия,
международным
2012),
на
участием
«Инновационные направления современной физиологии растений» (Москва,
2013), на VIII Съезде ОФР России и Всероссийской научной конференции
«Растения в условиях глобальных и локальных природно-климатических и
антропогенных воздействий» (Петрозаводск, 2015).
По теме диссертации опубликовано 4 статьи в журналах из перечня ВАК РФ
и цитируемых в РИНЦ, Scopus, Web of Science.
Объем и структура диссертационной работы. Диссертация изложена на
123 страницах, состоит из введения, обзора литературы, 3 глав собственных
исследований, заключения, выводов, списка сокращений, списка литературы.
Список литературы включает в себя 126 источников, в том числе 125 на
иностранном языке. Диссертация иллюстрирована 2 таблицами и 37 рисунками.
8
ГЛАВА 1. ОБЗОР ЛИТЕРАТУРЫ
1.1. Распространенность белков PII в природе
Сигнальные белки PII составляют одно из самых обширных семейств
сигнальных белков в природе. Растущий с каждым годом объем данных по
секвенированию указывает на то, что представители этого семейства широко
распространены и консервативны в геномах как прокариотических, так и
фототрофных
эукариотических
организмов.
Нередко
у
прокариот
они
представлены несколькими паралогами, выполняющими различающиеся функции
в регуляции процессов метаболизма азота и углерода. На сегодняшний день
выделяют четыре субсемейства PII-белков - GlnB, GlnK, NifI и PII-NG. Белки
GlnB и GlnK представлены у многих прокариот, они сходны по структуре и их
функции
могут
частично
перекрываться.
Примечательно,
что
фотосинтезирующие организмы, цианобактерии и растения имеют, как правило,
одного GlnB-гомолога PII (Sant’Anna et al., 2009; Osanai и Tanaka, 2007),
представленного у некоторых цианобактерий двумя паралогами (Laichoubi et al.,
2011). Для многих бактерий характерна консервативная колокализация в геномах
и совместная транскрипция представителей субсемейства GlnB с генами glnA или
nadE, кодирующими глутаминситетазу (GS) и глутамин-гидролизующую синтазу
НАД+ (Arconde´guy et al., 2001). В то же время GlnK-белки из семейства PII
котранскрибируются и напрямую взаимодействуют с транспортером аммония
AmtB (Forchhammer, 2008; Sant’Anna et al., 2009; Leigh и Dodsworth, 2007). В ряде
случаев паралоги GlnK называют GlnZ (Azospirillum braziliense) или GlnJ
(Rhodospirillum rubrum). Распространение белков другого субсемейства – NifI,
ограничивается
азотфиксирующими
археями
и
некоторыми
анаэробными
бактериями, а их функция заключается в контроле активности динитрогеназы
(Leigh и Dodsworth, 2007). Относительно недавно биоинформационный анализ
позволил выявить новое субсемейство
PII-белков, названное
PII-NG, у
представителей которого отсутствуют высоко консервативные характерные
паттерны PROSITE. Примечательным является совместная локализация в геномах
9
генов PII-NG с
генами транспортеров тяжелых металлов, хотя достоверно
функции белков PII-NG до сих пор не установлены (Sant’Anna et al., 2009).
Некоторое время назад GlnB-гомологи были выявлены в геномах таких
одноклеточных зеленых водорослей как Chlamydomonas reinhardtii (для которой
ранее сообщалось об отсутствии этого белка (Osanai и Tanaka, 2007), Micromonas
pusilla, Volvox carteri, Selenastrum minutum (Uhrig et al., 2009). Примечательно, что
у растений и зеленых водорослей гены, кодирующие PII, находятся в ядерном
геноме, хотя сами белки локализованы в хлоропласте (Hsieh et al., 1998; Smith et
al., 2004; Chen et al., 2006), тогда как у красных водорослей белки PII
закодированы в хлоропластном геноме (Uhrig et al., 2009).
Т.о., представители этого семейства сигнальных белков обнаружены во всех
трех доменах жизни – у бактерий, многих архей и в хлоропластах растений.
Однако, несмотря на высокую степень гомологии, свойства и функции этих
белков могут существенно отличаться у разных организмов.
1.2. PII бактерий
1.2.1. Грамотрицательные бактерии
γ-Протеобактерии. Белок PII впервые обнаружен при изучении регуляции
глутаминсинтетазы (GS) у E.coli путем аденилирования/деаденилирования в
зависимости от доступности азота в среде (Shapiro, 1969). Впоследствии
оказалось, что он является одним из наиболее консервативных белков у бактерий
и играет значительную роль в регуляции метаболизма азота у разных
представителей.
Организмы используют два основных способа ассимиляции аммония, такие
как
глутаминсинтетазный/глутаматсинтетазный
(GS/GOGAT)
путь
и
глутаматдегидрогеназный (GDH). Выбор пути ассимиляции аммония зависит от
его концентрации в среде (Reitzer, 2003). Несмотря на большую энергетическую
эффективность второго пути, глутаматдегидрогеназа имеет низкое сродство к
аммонию (Km более 1 мМ) и, по-видимому, неэффективна в условиях недостатка
10
азота.
В
этих
условиях
функционирует
система
глутаминсинтетаза/глутаматсинтетаза (GS/GOGAT) с использованием 1 М АТФ
на каждый моль аммония (Ермилова, 2012). Реакцию присоединения аммония к
углеродному цитоскелету осуществляет фермент глутаминсинтетаза (GS), в
результате чего образуется глутамин, который далее может вступать во второй
цикл
образования
глутамата,
катализируемый
глутамат-2-оксоглутарат-
аминотрансферазой (GOGAT).
Глутамат + АТФ +NH3
глутамин + АДФ +РО42- (GS)
Глутамин + 2-оксоглутарат + НАДФН
2глутамат + НАДФ+ (GOGAT)
При концентрациях аммония выше 1 мМ работает глутаматдегидрогеназа,
катализирующая следующую реакцию:
2-оксоглутарат + NH3 + НАДФН
глутамат + НАДФ+ (GDH)
Регуляция GS у бактерий осуществляется как на транскрипционном, так и
на посттранскрипционном уровнях. У энтеробактерий (E.coli) каталитическая
активность
этого
фермента
регулируется
путем
обратимой
ковалентной
модификации бифункциональным ферментом аденилилтрансферазой (AT) в
зависимости от доступности азота (Reitzer, 2003), а этот фермент, в свою очередь,
контролируется сигнальным белком PII (Shapiro, 1969).
Азотный статус клетки воспринимается уридилтрансферазой, в качестве
сигнала для которой служит абсолютная концентрация глутамина. Высокие
концентрации
глутамина
стимулируют
гидролазную
активность
уридилтрансферазы, что приводит к деуридилированию PII-УМФ, в то время как
низкие концентрации глутамина стимулируют трансферазную активность этого
фермента и происходит уридилирование PII. Принято считать, что глутамин
присоединяется к единственному сайту на уридилтрансферазе, с которого он
контролирует обе активности. Таким образом, немодифицированная форма PII в
клетках свидетельствует о достаточном количестве азота (низкое соотношение 2оксоглутарат/глутамин),
тогда
как
модифицированная
форма,
PII-УМФ,
сигнализирует о недостатке азота в клетках (высокое соотношение 2оксоглутарат/глутамин). От PII сигнал далее поступает на аденилилтрансферазу
11
(АТ) - фермент, регулирующий активность GS. 2-оксоглутарат (2-ОГ) в клетках
выступает в качестве основного сигнала углерода. На тримере, формируемом
субъединицами белка PII, имеется три участка для связывания 2-ОГ, который
влияет на возможность взаимодействия PII с NtrB. Сигнал от PII поступает на
регуляторный белок NtrC через киназу/фосфотазу NtrB, активируя фосфатазную
активность последней (Pioszak et al., 2000). Высокие концентрации 2-ОГ
блокируют присоединение PII к NtrB, приводя к снижению фосфатазной и
стимуляции киназной активности белка NtrB, в результате чего регулятор NtrC
фосфорилируется и активирует транскрипцию Ntr-регулируемых генов. Низкие
уровни 2-ОГ, напротив, стимулируют взаимодействие PII с NtrB, что ингибирует
киназную и активирует фосфатазную активность белка. Нефосфорилированный
белок-регулятор не активирует транскрипцию соответствующего оперона.
В геноме E.coli идентифицировано 2 гена, кодирующих представителей
семейства белка PII (glnB и glnK). Примечательно, что для glnB была показана
конститутивная транскрипция, а транскрипция glnK индуцируется в ответ на
азотное голодание регулятором NtrC. Белки GlnB и GlnK имеют 67%-ную
идентичность аминокислотных последовательностей и сходные биохимические
активности. Эти белки могут образовывать гетеротримеры, свойства которых, повидимому, отличаются от свойств гомотримеров, и считается, что этот механизм
используется бактериальными клетками для более тонкого контроля метаболизма
азота при разных внешних условиях (van Heeswijk et al., 2000). Так, при переносе
энтеробактерий из богатой азотом среды в бедную в клетках преобладает белок
GlnB, тогда как при длительном культивировании бактерий в среде с низким
содержанием азота – белок GlnK. Кроме того, GlnK способен связываться с
транспортером с высоким сродством к аммонию (AmtB) и регулировать его
активность в зависимости от ковалентной модификации (инактивация АmtB при
высокой концентрации аммония в среде) (Coutts et al., 2002; Javelle et al., 2004;
Ермилова , 2012).
В связи с тем, что PII энтеробактерий достаточно хорошо охарактеризован
на молекулярном уровне, на примере E.coli будут рассмотрены особенности
12
структурной организации и общие регуляторные способности этих белков.
Бактериальные PII представляют собой (гомо)тримерные белки из субъединиц с
молекулярной массой порядка 12-13 кДа, характеризующиеся достаточно высоко
консервативной трехмерной структурой (риcунок 1).
Рисунок 1. Пространственная структура тримера PII-белка E.coli. (По: Forchhammer, 2008).
Субъединицы тримера обозначены розовым, зеленым и синим цветами. Молекула АТФ в
комплексе с белком обозначена желтым цветом. Пунктирными линиями обозначены гибкие Тпетли.
А Вид молекулы сбоку.
Б Вид сверху.
Цилиндрическая
по
форме
молекула
обладает
тремя
длинными
выступающими наружу петлями: В, С и Т. Данные кристаллографии указывают
на высокую гибкость Т-петель в растворе, благодаря чему обеспечиваются
различные
конформационные
изменения
молекулы
и
белок-белковые
взаимодействия (Forchhammer, 2008).
Функционально PII-белки бактерий могут быть определены как сигнальные
интеграторы, для которых характерно два основных способа восприятия
сигналов. Универсальный консервативный способ состоит в связывании
эффекторных молекул АТФ, АДФ и 2-ОГ (Arcondéguy et al., 2001; Forchhammer,
2004; Ninfa и Jiang, 2005; Jiang и Ninfa, 2007). Три АТФ-связывающих сайта
13
локализованы в углублениях между соседними субъединицами и в присутствии
АТФ молекула PII может связывать до трех молекул 2-ОГ на тример (Ninfa и
Jiang, 2005; Xu et al., 1998; Sakai et al., 2005). Было показано, что в этом случае,
фосфаты от АТФ участвуют в формировании сайта связывания 2-ОГ. Три АТФсвязывающих сайта демонстрируют негативный кооперативный эффект и, к тому
же, они могут конкурентно связывать АДФ. Сродство к АТФ повышается в
присутствии 2-ОГ, но не влияет на сродство к АДФ (Jiang и Ninfa, 2007).
Передача сигналов через белки PII осуществляется путем прямых
взаимодействий
с
соответствующими
мишенями,
что
приводит
к
их
ингибированию, активированию или препятствию взаимодействий с другими
белками. Разнообразие взаимодействий PII с мишенями весьма широко. Однако, в
большинстве случаев, взаимодействие опосредовано высоко подвижной Т-петлей,
которая имеет первостепенное значение для большинства функций PII, участвуя в
формировании сайтов связывания эффекторных молекул. Связывание различных
лигандов приводит к конформационным изменениям Т-петли (Yildiz et al., 2007),
что опосредует взаимодействие с белками-мишенями PII. Многообразие
регуляторных взаимодействий определяется наличием ряда вариабельных
участков
в
последовательности
Т-петли.
Физиологическое
значение
и
биохимические характеристики связывания 2-ОГ белком PII описаны для
участков молекулы, названных Box1 и Box2. 2-оксоглутарат является основой при
биосинтезе аминокислот и его уровни характеризуют углеродный статус клетки.
Кроме того, на белках E. coli in vitro была показана важность связывания АДФ для
PII-рецепторных взаимодействий (Jiang и Ninfa, 2007).
Другой способ восприятия сигнала молекулой белка PII (не так универсален
и консервативен) – ковалентная модификация в области Т-петли. Для
протеобактерий характерно уридилирование по остатку тирозина 51 в ответ на
уровни глутамина, выступающего в роли индикатора N-статуса клетки (Reitzer,
2003; Ninfa и Jiang, 2005).
Т.о., связывание эффекторных молекул (аллостерическая модификация) и
ковалентная
модификация
в
области
Т-петли
приводят
к
изменениям
14
конформационного состояния белка. В зависимости от конформационного
состояния белок PII может связываться с различными мишенями, что приводит к
их ингибированию или активации. В результате в клетке происходят
адаптационные
изменения
за
счет
регуляции
транспортной
активности,
активности ключевых метаболических ферментов и уровней генной экспрессии
(рисунок 2).
АТФ
Входящий сигнал:
2-оксоглутарат
Gln Неидентифицированные
сигналы
Конформационные изменения белка PII
Аллостерическая модификация:
 Связывание АТФ и 2-оксоглутарата
Интеграция сигнала:
Ковалентная модификация:
 Gln-зависимое уридилирование
(Proteobacteria)
 Аденилирование (Actinobacteria)
 Фосфорилирование (Cyanobacteria)
Выходящий
сигнал:
Транспортная
активность
Ключевые
Экспрессия
метаболические генов
ферменты
активность
Рисунок 2. Регуляторная пластичность PII-белков. Пояснения в тексте. (По: Commichau et al.,
2006).
По
современным
мультифункциональными
представлениям
информационными
являются
PII-белки
процессорами,
зависимости от окружения дифференциально
которые
в
передают информацию об
энергетическом статусе и клеточных уровнях 2-ОГ и глутамина (Forchhammer и
Lüddecke, 2015). По-видимому, белки PII рано дивергировали от общего
предкового сигнального белка, что позволило
им приобрести
большое
разнообразие функций на основе общей структурной организации и сходных
сенсорных способностей.
15
α-Протеобактерии. Большинство проанализированных α-протеобактерий,
таких как р. Rhizobium, Bradyrhizobium, Azorhizobium, Acetobacter, Azospirillum,
Rhodobacter, Rhodospirillum, имеют по два или три гена PII. Так, например, у
Azospirillum brasiliense один ген кодирует белок, имеющий высокую степень
гомологии с GlnB, а другой – сходный с GlnK белок, тогда как в геноме R. rubrum
выявлено три гена PII-белков (GlnB, GlnK, GlnJ) (Zhang et al., 2001; Huergo et al.,
2012). Как правило, ген PII-белка glnB котранскрибируется c glnA (структурный
ген глутаминсинтетазы I), а glnK ассоциирован с гомологом amtB. Исключения
составляют Azospirillum brasilense, у которого glnK-подобный ген не связан с
amtB, а также Acetobacter diazotrophicus, имеющий помимо оперона glnBglnA, два
оперона glnKamtB.
Представители этой филы бактерий обладают такой уникальной в природе
способностью, как фиксация атмосферного азота. Восстановление N2 до NH3
является ключевым этапом круговорота азота, который осуществляет ряд
прокариотических микроорганизмов. Этот процесс катализируется нитрогеназой,
наиболее распространенной формой которой является молибденовая нитрогеназа.
Этот фермент состоит из гетеротетрамера динитрогеназы (MoFe-белок или
NifDK) и гомодимера редуктазы динитрогеназы (Fe-белок или NifH). Как
известно, процесс превращения одной молекулы атмосферного азота N2 в 2
молекулы NH3 является энергетически высоко затратным и требует гидролиза 16
молекул АТФ. В связи с этим организмы приобрели механизмы тонкой
многоступенчатой регуляции работы нитрогеназы, функционирующие на разных
уровнях. В частности, многие диазотрофы, включая бактерий и архей,
демонстрируют посттрансляционную регуляцию активности этого фермента. У
протеобактерий ферменты DraT и DraG ковалентно модифицируют белок NifH
(редуктаза динитрогеназы). АДФ-рибозилирование осуществляется белком DraT,
а обратная реакция белком DraG (рисунок 3). На примере азотфиксирующих αпротеобактерий бактерий подробно изучена роль белков PII (GlnB и GlnK) и
AmtB в регуляции активности DraT и DraG (Huergo et al., 2012). Когда клетки
находятся в условиях фиксации атмосферного азота, белки GlnB и GlnK
16
полностью уридилированы, локализованы в цитоплазме и соответствующие
сайты насыщены АТФ и 2-ОГ (на рисунке 3 обозначено +), в результате чего DraT
и DraG не связаны с белками PII. В этих условиях DraT неактивен, а DraG
находится в цитоплазме в активном состоянии. Это приводит к активации
нитрогеназы, поскольку NifH находится в нерибозилированном состоянии. При
повышении уровней аммония GlnK и GlnB деуридилируются, т.к. увеличение
уровней внутриклеточного глутамина приводит к активации деуридилазной
активности GlnD. Снижение уровней 2-ОГ приводит к замещению АТФ на АДФ в
PII-белках (на рисунке 3 обозначено *). В результате DraG секвестрируется к
мембране, взаимодействуя с AmtB и GlnK, где он не может взаимодействовать с
NifH, который остается в неактивной, АДФ-рибозилированной конформации. В
свою очередь DraT активируется при взаимодействии с неуридилированным,
насыщенным молекулами АДФ GlnB.
Рисунок 3. Роль белков GlnK и GlnВ в регуляции активности DraT и DraG при ответе на
аммоний. Пояснения в тексте. (По: Huergo et al., 2012).
17
Т.о.,
у
α-протеобактерий
появляется
принципиально
иной
способ
негативной регуляции с использованием белка PII, при котором PII контролирует
доступность регуляторных факторов путем формирования нерабочих комплексов
или клеточной релокализации. Как оказалось, подобный механизм широко
распространен
у
бактерий
и
сходные
примеры
PII-регуляции
у
грамположительных бактерий и цианобактерий будут описаны ниже.
Кроме того, в недавних исследованиях по поиску дополнительных мишеней
PII у Azospirillum brasilense с использованием метода аффинной хроматографии
был выявлен белок BCCP (biotin carboxyl carrier protein) (Rodrigues et al., 2014).
Эта новая мишень, демонстрировавшая взаимодействие с белком GlnZ,
представляет собой компонент ацетил-CoA карбоксилазы (ACC), которая
катализирует ключевой этап биосинтеза жирных кислот. Кроме того, с
использованием синтетических белков BCCP и GlnK E.coli была показана
консервативность взаимодействия PII-BCCP у бактерий. Необходимым условием
стабильности комплекса этих белков является наличие Mg-АТФ, а 2-ОГ приводит
к диссоциации комплекса PII-BCCP. Хотя в ходе этого исследования и не было
выявлено строгой зависимости от уровня уридилирования PII,
однако была
показана строгая зависимость от другой посттрансляционной модификации –
биотинилирования BCCP. Только биотинилированная форма BCCP способна
выступать в качестве мишени PII. На основе особенностей структуры белка BCCP
и его взаимодействия с PII авторами было выдвинуто предположение об участии
биотина в формировании сайта связывания PII. Однако в последующих
исследованиях этой группы исследователей было обнаружено, что именно GlnB, а
не GlnK, способен формировать тройной комплекс с белками BC-BCCP
(компонентами ACCазы), в результате чего ингибируется активность ACCазы
(Gerhardt et al., 2015). Высокие концентрации 2-ОГ и уридилирование GlnB
приводят к диссоциации комплекса BC-BCCP-GlnB и снятию ингибирования
ACCазы. Идентификация BCCP в качестве мишени PII у бактерий указывает на
более широкую роль PII, чем только регуляция метаболизма азота, и выявляет
18
дополнительную регуляторную связь между метаболизмом азота и углерода
(Rodrigues et al., 2014; Gerhardt et al., 2015).
β-Протеобактерии.
Два
типичных
представителя
β-протеобактерий,
Herbaspirillum seropedicae и Azoarcus sp., были изучены в деталях. H.seropedicae
имеет два PII-подобных гена, один из которых связан с гомологом E. сoli nadE
(ген, кодирующий аммоний-зависимую НАД-синтазу) (Benelli et al., 1997).
Azoarcus sp. имеет три PII-подобных гена – один гомолог glnB и два гомолога
glnK, каждый из которых связан с гомологом amtB (glnK с amtB и glnY с amtY).
Два гена PII, glnK и glnY, транскрибируются в основном при фиксации азота
(Martin et al., 2000).
Цианобактерии. Представитель PII-белков у цианобактерий впервые был
обнаружен в конце 80-х гг. у Synechococcus sp. (штамм PCC6301) при изучении
фосфорилирования белков (Sanders et al., 1989). Исследователи обратили
внимание на Р32-меченный белок с молекулярной массой 12,5 кДа. При
секвенированиии N-концевой последовательности очищенного белка была
выявлена идентичность порядка 62-66% с N-концом GlnB E. coli и других
протеобактерий
(Harrison
последовательностей,
у
et
al.,
1990).
большинства
В
дальнейшем,
цианобактерий
были
при
анализе
обнаружены
единичные гены семейства glnB, а гомолог glnK отсутствовал вовсе (Arcondéguy
et al., 2001; Forchhammer, 2004). Сравнительный анализ последовательностей
белков GlnB разных цианобактерий и их гомологов у других бактерий привел к
идентификации 14 уникальных и характерных для всех цианобактерий
аминокислот (Palinska et al., 2002). Интересно то, что большая их часть находится
в
области
Т-петли,
отвечающей
за
функциональные
взаимодействия
и
конформационные изменения молекулы белка.
При недостатке азота в среде белок PII цианобактерий подвергается
ковалентной модификации путем фосфорилирования (а не уридилирования) по
остатку Ser-49, располагающемуся в том же участке Т-петли, что и Tyr-51 E. сoli
(Forchhammer et al., 1994). В последовательностях GlnB и GlnK протеобактерий
положение, соответствующее Ser-49, занято аланином. Тримерный белок GlnB
19
цианобактерий
может
присутствовать
в
четырех
различных
формах
–
немодифицированной или три модифицированных (с одной, двумя или тремя
фосфорилированными субъединицами). Эти формы отличаются по своей
электрофоретической подвижности и выявляются при иммуноблоттинге в
неденатурирующем ПААГ (Forchhammer и Tandeau de Marsac, 1994).
Белок PII S. elongatus, как и другие бактериальные PII-белки, строго
реагирует на азотный статус клетки. В растущих на богатой аммонием среде
клетках белок практически полностью дефосфорилирован, тогда как при росте на
нитрате в качестве источника азота фосфорилирование PII возрастает до
промежуточных уровней. В условиях голодания по азоту этот белок максимально
фосфорилируется (Forchhammer и Tandeau de Marsac, 1994; Forchhammer и
Tandeau de Marsac, 1995). Однако, по-видимому, фосфорилирование PII отвечает
не на конкретный источник азота, а скорее на его ассимиляцию через
глутаминсинтазный/глутаматсинтетазный путь (GS/GOGAT). Ингибирование
одного из ферментов этого пути ведет к резкому повышению фосфорилирования,
даже в присутствии аммония (Irmler et al., 1997), что предполагает участие
метаболитов
этого
пути
в
фосфорилированиии
белка
PII.
In
vivo на
фосфорилирование/дефосфорилирование PII оказывает влияние не только
азотный статус клетки. Было показано, что помимо добавления аммония,
вызывающего дефосфорилирование PII, сходный эффект может быть достигнут
путем ингибирования фиксации или ограничения притока
СO2 к клеткам
(Forchhammer и Tandeau de Marsac, 1995; Irmler et al., 1997). Различные условия
освещения и перемещение клеток из темноты на свет также оказывают влияние на
состояние фосфорилирования PII. Однако считается, что эти эффекты вторичны
по отношению к условиями азотного статуса (Forchhammer и и Tandeau de Marsac,
1994). Для Synechocystis sp. PCC 6803 также было показано, что белок GlnB может
отвечать
на
состояние
восстановленности
фотосинтетической
электрон-
транспортной цепи (Hisbergues et al., 1999).
Фосфорилирование PII может осуществляться только в присутствии 2-ОГ и
АТФ. Фосфатазная активность, стимулируемая Mg2+, напротив, ингибируется
20
АТФ и 2-ОГ (Irmler et al., 1997). Киназная и фосфатазная активности могут быть
разделены
методом
гель-фильтрационной
хроматографии.
Несмотря
на
многочисленные попытки до сих пор не удалось идентифицировать основу
киназной активности. Экспериментальные данные указывают на то, что
фосфорилирование осуществляют либо многочисленные взаимозаменяемые
киназы, либо какая-то уникальная, до сих пор не идентифицированная киназа.
Фосфатаза же демонстрирует биохимические свойства, типичные для белковых
фосфатаз семейства 2С (PP2C) (Irmler et al., 1997).
Возможности
РII
S.
еlongates
взаимодействовать
с
эффекторными
молекулами во многом сходны с таковыми у GlnB E. coli, хотя очевидны
некоторые различия, которые могут иметь важные физиологические последствия
(Forchhammer и Hedler, 1997; Forchhammer, 1999). Оба белка связывают АТФ и 2ОГ взаимозависимо. Отличительной особенностью цианобактериального PIIбелка является то, что АТФ и 2-ОГ не только взаимно влияют на сродство
связывания соответствующего лиганда, но и уменьшают взаимный негативный
эффект соседних лиганд-связывающих сайтов в тримере белка (Forchhammer и
Hedler, 1997).
Физиологические исследования показали, что PII-зависимая передача
сигналов характерна для регуляции утилизации нитрата, поглощения бикарбоната
и генной экспрессии через глобальный регулятор азотного метаболизма NtcA
(Forchhammer 2004). По-видимому, регуляция утилизации нитрата с участием
белка PII осуществляется по нескольким путям, включая аммоний-зависимый
(Lee et al., 2000) и световой (Kloft и Forchhammer, 2005) контроль поглощения
нитрата, и, возможно, контроль активности нитратредуктазы у S. elongatus
(Takatani et al., 2006). Некоторое время назад скрининг геномных библиотек
позволил обнаружить новые мишени PII-белка, такие как
N-ацетил-L-
глутаматкиназа (NAGK) (Heinrich et al., 2004; Burillo et al., 2004) и малый белок
PipX (Burillo et al., 2004; Espinosa et al., 2006) у S. elongatus, а также
предполагаемый мембранный белок PamA у Synechocystis (Osanai et al., 2005).
21
NAGK
представляет
собой
фермент,
катализирующий
скорость-
лимитирующую стадию биосинтеза аргинина (рисунок 4). Его активность
контролируется образованием комплекса с PII и
обратимо ингибируется
аргинином (Maheswaran et al., 2004; Maheswaran et al., 2006; Forchhammer, 2008).
Рисунок 4. Взаимодействие PII–NAGK и контроль биосинтеза аргинина у одноклеточных
цианобактрий. Пояснения в тексте. (По: Forchhammer, 2008).
В
условиях
энергетическом
недостатка
голодании
азота
(высокие
(высокие
уровни
уровни
АДФ),
2-ОГ)
PII
не
или
при
способен
взаимодействовать с NAGK (на рисунке слева). В этом случае NAGK остается в
состоянии низкой активности и
высоко чувствителен к ингибированию
аргинином. Уровень ингибирования регулируется в соответствии с количеством
необходимого аргинина для белкового синтеза. Кроме того, комплекс с NAGK
формирует только немодифицированный белок PII S. elongatus, тогда как
фосфорилированный по Ser-49 PII не
способен взаимодействовать с NAGK
(Heinrich et al., 2004). В условиях достаточного количества азота и энергии
(низкие уровни 2-ОГ и АДФ) формируется комплекс PII-NAGK, повышающий
каталитическую
активность
NAGK
и
резко
снижающий
ингибирование
аргинином (на рисунке справа). В результате уровни клеточного аргинина растут,
22
и он может быть использован для синтеза белков или запасания источника азота в
виде цианофицина (Maheswaran et al., 2006).
Упомянутый выше белок PipX также является мишенью PII. Он
представляет
обнаруженный
собой
у
малый
всех
белок
из
цианобактерий.
89
аминокислот,
Наряду
с
PII,
уникальный
он
и
способен
взаимодействовать с глобальным регуляторным белком NtcA (Espinosa et al.,
2006; Espinosa et al., 2014; Forchhammer, 2008). Формирование комплекса
мономерного белка PipX с PII или NtcA зависит от присутствия 2-ОГ (рисунок 5).
Сродство PII к PipX возрастает при низких уровнях 2-ОГ (высокое соотношение
азот/углерод). Тогда как в условиях голодания по азоту (высокие уровни 2-ОГ)
PipX высвобождается от PII и связывается с NtcA, что приводит к увеличению
экспрессии NtcA-зависимых генов (Espinosa et al., 2007). Было показано, что PipX
функционирует как транскрипционный ко-активатор NtcA. На рисунке 5
представлено схематическое изображение модели взаимодействия PII с PipX и
NAGK в зависимости от азотного статуса клетки (Espinosa et al., 2014). Однако
недавно был получен фактический материал, указывающий на наличие NtcAнезависимого
регулона
PipX,
который
включает
не
только
регуляцию
метаболизма азота, но и адаптацию процессов трансляции и фотосинтеза к
изменениям окружающей среды (Espinosa et al., 2014). По всей видимости, в этом
случае PipX воспринимает сигналы, отличные от 2-ОГ, что указывает на
мультифункциональные свойства этого белка и сложную систему регуляции.
23
Рисунок 5. Модель зависимого от 2-ОГ взаимодействия PipX и PII с мишенями. Пояснения в
тексте. (По: Espinosa et al., 2014).
Еще одна мишень PII – белок PamA Synechocystis, мембранный белок с
неизвестной функцией. Его С-терминальный домен имеет высокую степень
сходства с механочувствительными каналами семейства MscS (Osanai et al., 2005).
Этот домен взаимодействует с PII в зависимости от присутствия АТФ и 2-ОГ, что
указывает на участие PII в регуляции этого потенциального канала в условиях
недостатка азота. Также было показано возрастание экспрессии NtcA-зависимых
генов у мутанта с делецией по гену pamA. Этот ген включает в себя
последовательность sigE, кодирующую альтернативный сигма-фактор, для
которого была показана активация в условиях недостатка азота и участие в
контроле уровней транскрипции генов катаболизма сахаров (Osanai и Tanaka,
2007).
1.2.2. Грамположительные бактерии
Фирмикутные бактерии. Одним из наиболее изученных представителей
грамположительных бактерий на предмет PII-белков является Bacillus subtilis, у
которого имеется единственный ген PII (GlnK-гомолог), обладающий рядом
уникальных особенностей (Wray, 1994). Mg2+ выступает антагонистом связывания
АТФ, а 2-ОГ практически не связывается с белком PII вне зависимости от
24
концентрации АТФ. Более того, для этого белка не характерна ковалентная
модификация. В условиях недостатка азота глобальный регулятор TnrA
активирует экспрессию приблизительно 15 генов, продукты которых вовлечены в
поглощение и утилизацию альтернативных источников азота, в том числе
экспрессию генов nrgAB, кодирующих транспортер аммония AmtB и PII-белок
GlnK (рисунок 6) (Gunka и Commichau, 2012). Было показано, что в присутствии
менее предпочтительных источников азота, таких как нитрат, и низких уровней
АТФ в клетках транскрипционный регулятор TnrA и белок GlnK формируют
комплекс с транспортером AmtB (Heinrich et al., 2006). В этих условиях
экспрессируются гены glnRA, кодирующие GS и регулятор транскрипции GlnR,
что приводит к внутриклеточному синтезу глутамина. TnrA слабо репрессирует
оперон glnRA. Ряд экспериментальных данных указывает на то, что GS у Bacillus
subtilis функционирует как сенсор уровней азота (Fisher, 1999; Wray et al., 2001). В
условиях избытка азота, обратимо ингибированная глутамином и АМФ GS (FBIGS) связывается и ингибирует регулятор TnrA. Кроме того, FBI-GS стабилизирует
связывание GlnR с промоторами генов tnrA и glnRA, что приводит к репрессии
соответствующих генов (рисунок 6).
Рисунок 6. Контроль ассимиляции азота у B. subtilis. Пояснения в тексте. (По: Gunka и
Commichau, 2012).
25
Кроме того, клеточные уровни TnrA регулируются путем протеолиза
(Kayumov et al., 2008). После перенесения клеток Bacillus на среду без
метаболизируемого источника азота TnrA высвобождается и подвергается
протеолизу в течение 15 минут. В этих условиях GS должна быть в высоко
активном, не ингибированном состоянии, что снижает ее сродство к TnrA. Это
приводит к тому, что TnrA распознается протеазами и деградирует. Однако, когда
TnrA находится в комплексе с GS до удаления из среды источника азота, как и в
случае с мутантом по GlnK, TnrA остается связанным и защищен от протеолиза
(Kayumov et al., 2011).
Анализ последовательностей по базам данных выявил также наличие glnBподобных
генов
у
Clostridium
acetobutylicum,
Clostridium
cellobioparum,
Clostridium longisporum и Listeria monocytogenes (Brown и Thomson, 1998).
Актинобактерии. Регуляция метаболизма азота достаточно хорошо
изучена
на
примере
коммерчески
важного
продуцента
аминокислот
–
Corynebacterium glutamicum (Burkovski, 2007; Ермилова, 2012). Подобно
энтеробактериям C. glutamicum ассимилирует аммоний двумя основными
способами – по GS/GOGAT и GDH путям. Активность GS, кодируемой геном
glnA, также контролируется путем посттрансляционного аденилирования/
деаденилирования
бифункциональным
ферментом
GlnE.
Однако
GlnЕ
функционирует независимо от GlnD. Адаптация C. glutamicum к условиям
недостатка
азота
на
уровне
транскрипции
контролируется
глобальным
регулятором AmtR, который в условиях достаточного обеспечения азотом
репрессирует ряд генов, в том числе оперон amtBglnKglnD. Однако при
появлении достаточного количества азота в среде AmtR взаимодействует с
находящимся в цитоплазме сигнальным трансдукторным белком GlnK, в
результате он теряет способность взаимодействовать с ДНК и снимается
репрессия соответствующих генов (Jakoby et al., 1999; Jakoby et al., 2000; Nolden et
al., 2001). Для актинобактерий характерно наличие единственного PII-гомолга
(GlnK). Было показано, что с AmtR взаимодействует только модифицированная
26
форма GlnK (Beckers et al., 2005; Strosser et al., 2004). Подобно энтеробактериям
модификация GlnK осуществляется по остатку Tyr-51 Т-петли ферментом GlnD
(Nolden et al., 2001). Однако позднее выяснилось, что GlnD C.glutamicum
функционирует как аденилилтрансфераза в отличие от уридилтрансферазы E.coli
(Strosser, 2004). Позднее аденилирование белка PII было также показано на
Streptomyces coelicolor (Hesketh et al., 2002). Т.о., актинобактерии демонстрируют
еще один способ посттрансляционной модификации белков PII – аденилирование.
GlnD
C.glutamicum
функционирует
как
бифункциональный
фермент,
а
транскрипция его гена (glnD) возрастает в условиях недостатка азота. Эти данные
указывают на то, что GlnD не является первичным сенсором азотного статуса
клетки у C.glutamicum (Nolden et al., 2001, Burkovski, 2007).
Помимо посттрансляционной модификации для белка GlnK C. glutamicum
было показано изменение внутриклеточной локализации в ответ на изменение
уровней азота в среде. В то время как при азотном голодании GlnK представлен в
цитоплазме, при добавлении аммония около 2-5% этого белка секвестрируется к
цитоплазматической мембране с участием транспортера аммония
AmtB.
Подобный механизм связывания GlnK с AmtB оказался достаточно консервативен
и широко распространен среди других бактерий, таких как E.coli, B. subtilis,
Azotobacter vinelandii (Coutts et al., 2002; Detsch и Stülke, 2003; Javelle et al., 2004).
Было показано, что при добавлении аммония основная часть GlnK подвергается
протеолизу, тогда как 2-5% не деградирует. Детали данного процесса пока не
ясны, однако было показано, что и протеолиз GlnK у C.glutamicum и защита от
деградации у других бактерий зависят от присутствия пермеазы аммония AmtB
(Burkovski, 2007). Схематическое изображение регуляции метаболизма азота у
C.glutamicum представлено на рисунке 7.
27
Рисунок 7. Регуляция метаболизма азота C.glutamicum. Пояснения в тексте. (По: Burkovski,
2007).
Т.о., механизмы контроля метаболизма азота у C.glutamicum с участием PIIбелка GlnK включают как уровни регуляции экспрессии генов, так и активности
белков, и осуществляются путем репрессии транскрипции, белок-белковых
взаимодействий,
модификации
путем
аденилирования,
изменения
внутриклеточной локализации и протеолиза.
В последние годы в литературе также появились данные по исследованию
роли PII у микобактерий. Так, было показано, что в геноме патогена M.
tuberculosis присутствует единственный представитель PII-белков, имеющий
61,1% идентичности белку GlnB и 54% идентичности белку GlnK E.coli (Cole et
al., 1998). Однако, после определения кристаллической структуры PII M.
tuberculosis была показана структурная консервативность с GlnK-белками. Кроме
того, колокализация соответствующего гена в одном опероне с amtB и glnD
дополнительно указывает на то, что PII M.tuberculosis является представителем
субсемейства GlnK, а не GlnB (Shetty et al., 2010). Относительно недавно были
получены экспериментальные доказательства того, что GlnK микобактерий
28
(непатогенного M. smegmatis и патогенного M. tuberculosis), как и у других
актиномицетов,
подвергается
посттрансляционной
модификации
путем
аденилирования по Tyr-51 в условиях недостатка азота (Williams et al., 2013).
GlnD был выявлен как фермент, осуществляющий реакцию аденилирования.
Также было показано, что состояние аденилирования GlnK M. tuberculosis не
регулирует аденилирование GS, но в отличие от PII E.coli и С. glutamicum, не
опосредует транскрипционный ответ клетки в условиях недостатка азота
(Williams et al., 2013).
1.3. PII архей
У
представителей
архей,
обладающих
способностью
к
фиксации
атмосферного азота, были выявлены белки NifI из семейства PII. Большинство
исследований по изучению контроля активности нитрогеназы архей было
выполнено на Methanococcus maripaludis и был показан принципиально иной от
АДФ-рибозилирования
механизм
регуляции
этого
фермента.
В
геноме
M.maripaludis находится 5 генов, кодирующих PII-белки, два из которых nifI и
nifI2 локализованы между генами nifH и nifD, кодирующими субъединицы
динитрогеназы/редуктазы динитрогеназы (Kessler и Leigh, 1999). В отличие от
протеобактерий, для которых характерна PII-зависимая регуляция редуктазы
динитрогеназы (NifH), у архей контроль осуществляется через динитрогеназу
(NifDK). Было показано, что ингибирующий эффект NifI1и NifI2на нитрогеназу
осуществляется при прямом взаимодействии гетеромера NifI1/NifI2 с компонентом
NifDK (рисунок 8). Это взаимодействие нарушается в присутствии 2-ОГ, который
провоцирует дальнейшую олигомеризацию NifI1/NifI2 (Dodsworth и Leigh, 2006).
Связывание гетеромерного NifI1/NifI2 с NifDK предотвращает ассоциацию
последнего с NifH, что приводит к прерыванию электрон-транспортной цепи
(Dodsworth и Leigh, 2007). Т.о., в условиях фиксации азота наблюдаются высокие
внутриклеточные концентрации 2-ОГ, который связывается с NifI и усиливает
формирование олигомеров NifI1/NifI2 более высокого порядка (вероятно,
додекамеров), что препятствует их взаимодействию с NifDK. При появлении
аммония внутриклеточные концентрации 2-ОГ падают, а гетеромер NifI1/NifI2
29
превращается в олигомер с меньшей молекулярной массой (вероятно, гексамер),
который взаимодействует с NifDK, предотвращая взаимодействие с NifH, в
результате чего нитрогеназа инактивируется (рисунок 8) (Huergo et al., 2012).
Рисунок 8. Роль PII в регуляции активности нитрогеназы у архей. Пояснения в тексте. (По:
Huergo et al., 2012).
Следует отметить, что nifI-гены представлены у всех азотфиксирующих
архей и у некоторых анаэробных бактерий, включая представителей Proteobacteria, Firmicutes, Chlorobi, Chloroflexi. Наличие nifI-генов как у архей,
так и у бактерий предполагает их раннее эволюционное происхождение. Согласно
современным
нитрогеназы
представлениям
является
NifI1/NifI2-зависимый
эволюционно
более
контроль
древним
по
активности
сравнению
с
посттрансляционным способом регуляции нитрогеназы (Huergo et al., 2012).
Кроме того, среди представителей Euryarchaeota достаточно широко
распространены GlnK-белки. Так, например, в геноме M. mazei содержатся гены
для белков glnK1 и glnK2, для которых характерна колокализация в одном
опероне с amtB, хотя долгое время не было экспериментальных доказательств их
взаимодействия в клетках архей (Leigh и Dodsworth, 2007). Однако недавно на
таком объекте как Haloferax mediterranei было показано, что аммониевый шок
приводит к ассоциации GlnK с AmtB на мембране, подтверждая предположение о
консервативности пары GlnK-AmtB в качестве сенсора азота у архей (Pedro-Roig
et al., 2013в). По аналогии с бактериями археотный GlnK может блокировать
транспортер аммония AmtB1 в богатых по азоту условиях. Более того, была
30
показана регуляция на уровне транскрипции для пары генов amtB-glnK у архей в
зависимости от количества доступного азота. При недостатке азота наблюдались
высокие уровни экспрессии, тогда как появление метаболизируемого источника
азота приводило к значительному снижению транскрипции. Однако, несмотря на
консервативность регуляции уровней транскриптов этой пары генов по
сравнению с бактериями, у архей не было выявлено ни характерной для бактерий
двухкомпонентной регуляторной системы NtrB-NtrC, ни 54-фактора, в связи с
чем авторы предположили наличие отличного механизма контроля транскрипции
(Pedro-Roig et al., 2013в). Также в серии работ этой исследовательской группы
было показано, что GlnK Hfx. mediterranei подвергается посттрансляционной
модификации путем уридилирования (Pedro-Roig et al., 2013а). Кроме того, in vitro
на рекомбинантных белках было показано прямое взаимодействие обоих белков
GlnK с GS, что приводило к возрастанию активности GS в присутствии 2-ОГ
(Pedro-Roig et al., 2013б). Эти данные предполагают, что археи, как и бактерии,
ассимилируют аммоний по энергетически затратному пути GS-GOGAT только в
условиях недостатка азота. В связи с тем, что PII-белки у архей изучаются
относительно недавно, остается много белых пятен в понимании деталей
механизмов регуляции. Однако уже сегодня полученные экспериментальные
данные указывают на высокую степень консервативности отдельных элементов
PII-опосредованной регуляции у прокариот.
1.4. PII эукариот
Высшие растения. Координация процессов метаболизма азота и углерода у
высших растений особенно сложна в связи с многоклеточным строением этих
организмов и тканевой специализацией. Азот, поглощаемый корнями в форме
нитрата, должен быть тут же восстановлен до нитрита и либо использоваться в
корневом метаболизме азота, либо транспортироваться в фотосинтетические
ткани для включения в состав аминокислот. Напротив, углерод фиксируется из
воздуха в процессе фотосинтеза и в виде соответствующих предшественников
также включается в процессы ассимиляции азота и биосинтеза аминокислот, либо
31
транспортируется в корни в форме сахаров для обеспечения там достаточного
количества энергии и углеродных скелетов органических молекул. Столь сложная
система
должна
иметь
сложный
многоступенчатый
контроль.
Для
прокариотических организмов уже достаточно давно было показано, что
ключевая роль в координации процессов метаболизма азота и углерода
принадлежит сигнальному белку PII. Несмотря на то, что этот белок был
достаточно хорошо охарактеризован у бактерий, для растений он оставался не
идентифицированным вплоть до 1998 года (Hsieh et al., 1998). И до сих пор
немногочисленные данные касаются, в основном, двух представителей –
Arabidopsis thaliana и Oryza sativa (Sugiyama et al., 2004).
Как и у цианобактерий, в геноме растений обнаружен единственный
представитель семейства PII-белков - GlnB-гомолог (GLB1) (Sant’Anna et al.,
2009; Osanai и Tanaka, 2007). Была показана высокая степень идентичности с
цианобактериальными представителями семейства (50-54%). Молекулярная масса
мономера составляет порядка 15 кДа, гомотримера – 45 кДа (Mizuno et al., 2007).
У растений и одноклеточных водорослей этот белок закодирован в ядре, но имеет
хлоропластную локализацию (Hsieh et al., 1998; Uhrig et al., 2009). N-концевая
последовательность кодирует транзитный пептид хлоропластной локализации,
который отрезается у зрелого белка. Кроме того, у растений и зеленых водорослей
были обнаружены уникальные N- и С-концевые последовательности, не
найденные в соответствующих белках других организмов (рисунок 9). Хотя
функции этих участков до сих пор не ясны, высокая консервативность
последовательностей и их поверхностная локализация вблизи сайта связывания
АТФ, предполагает возможную роль в сигнальных взаимодействиях с другими
белками (Uhrig et al., 2009).
32
А
хлТП
ПП
N-концевая Консервативный участок
вставка
Б
С-концевая
вставка
Высшие растения и зеленые водоросли
Прокариоты и красные водоросли
Рисунок 9. Белок PII высших растений. (По: Uhrig et al., 2009; Smith et al., 2003).
A Схематическая диаграмма доменной организации белка PII
у прокариотических и
эукариотических организмов: центральный участок (желтый) и Т-петля (розовый) высоко
консервативны у всех организмов, тогда как хлоропластный транзитный пептид (хлТП,
зеленый) и N- и C-концевые вставки (синий и красный, соответственно) уникальны для высших
растений и зеленых водорослей. Ser-49 и Tyr-51, локализованные в консервативном участке Тпетли, подвергаются фосфорилированию и уридилированию, соответственно, у цианобактерий
и ряда протеобактерий.
Б Схематическое изображение вторичной структуры мономера белка PII у Arabidopsis thaliana.
Последовательность Т-петли растительного белка содержит от 5 до 14
аминокислот, уникальных и характерных для PII цианобактерий. Примечательно,
что в области Т-петли содержится высоко гомологичный, характерный для
цианобактерий сайт фосфорилирования (Ser-49 у Synechocystis/Synechococcus и
Ser-60 у Arabidopsis thaliana), а сайт уридилирования Tyr-51 (E. coli) замещен
фенилаланином.
Однако
проведенные
эксперименты
не
подтвердили
предположение о фосфорилировании растительного PII-белка по Ser-60 в Т-петле
(Smith et al., 2004). Авторы предположили, что необходимые условия не были
достигнуты в экспериментах. Однако также возможно, что эволюционно растения
утратили клеточную машину, необходимую для фосфорилирования PII (PIIкиназа/PphAфосфатаза).
Как и прокариотические белки, PII Arabidopsis thaliana способен связывать
с высоким сродством АТФ/АДФ и 2-ОГ, что указывает на участие этого белка в
33
контроле энергетического и углеродного статуса пластид (Beez et al., 2009; Chen
et al., 2006). Однако, несмотря на достаточно широкий спектр мишеней
прокариотических
до
PII-белков,
идентифицированной
мишенью
у
недавнего
растений
времени
оставалась
единственной
NAGK.
Как
и
цианобактериальный гомолог этого белка, NAGK Arabidopsis осуществляет
превращение N-ацетилглутамата (NAG) в N-ацетилглутамилфосфат, что является
ключевым этапом биосинтеза аргинина, а последний в свою очередь способен
обратимо
ингибировать
растительным
NAGK
NAGK.
также
Связывание
приводит
к
сигнального
высвобождению
белка
PII
фермента
с
от
ингибирования аргинином. Наряду с высокой консервативностью механизма
этого контроля и структуры комплекса PII-NAGK у цианобактерий и Arabidopsis,
имеется ряд различий (Beez et al., 2009). На уровне ферментативной активности
разница выявляется в способности PII активировать ингибированный аргинином
NAGK. По литературным данным уровень активности A. thaliana NAGK
(AtNAGK) умеренно возрастает при формировании комплекса с PII (30%
увеличение Vmax и не выявлен эффект на Km) (Chen et al., 2006), тогда как для
фермента S.elongatus была показана значительная активация при связывании с PII,
сопровождающаяся ростом Vmax и снижением Km (Maheswaran et al., 2004;
Maheswaran et al., 2006). Степень ингибирования аргинином также значительно
отличается для этих двух белков: SeNAGK приблизительно в 50 раз более
чувствителен к аргинину, чем AtNAGK. Более того, были предположены
структурные основы этой разницы чувствительности к аргинину (Beez et al.,
2009).
Неконсервативный
пептид
на
С-конце
SeNAGK
представляется
негативным детерминантом активности NAGK и взаимодействия с PII.
Предположительно, он снижает каталитическую активность свободного NAGK и
увеличивает ингибирующий эффект аргинина, хотя детали данного механизма
еще предстоит выяснить. Несмотря на выявленную разницу в чувствительности к
аргинину, для обоих белков при связывании с PII характерна сходная динамика
высвобождения NAGK от ингибирования аргинином. Было также показано, что
АДФ приводит к диссоциации комплекса SeNAGK-PII, тогда как не выявлено
34
подобного эффекта для AtNAGK-PII. В обоих системах 2-ОГ делает комплекс PIINAGK доступным для ингибирования аргинином, хотя механизм его действия
отличается в деталях (Beez et al., 2009). Цианобактериальная система
представляется более простой в этом отношении, где снижение активности NAGK
опосредовано диссоциацией комплекса с PII под действием 2-ОГ. Тогда как у
Arabidopsis ингибирующее активность действие 2-ОГ не сопровождалось
диссоциацией комплекса PII-NAGK, в связи с чем был предположен более
сложный механизм действия 2-ОГ (Beez et al., 2009). Относительно низких
концентраций 2-ОГ может быть достаточно для конформационных изменений PII,
которые не позволяют снимать ингибирование NAGK аргинином, но полной
диссоциации комплекса при этом не происходит. Несмотря на некоторые важные
различия в деталях, обращает внимание поразительная консервативность
взаимодействия PII-NAGK между различными доменами жизни, на что
дополнительно
указывают
полученные
in
vitro
данные
по
частичной
взаимозаменяемости белков Synechococcus и Arabidopsis (Beez et al., 2009).
Несколько лет назад в литературе появились сообщения о взаимодействии
PII Arabidopsis с BCC-белками, которые подобно бактериальным BCCP, являются
компонентами пластидного АССазного комплекса (Feria Bourrellier et al., 2010).
Эти белки выявлялись в связи с PII только в присутствии Mg-АТФ и
специфически
элюировались
буфером
с
2-ОГ.
В
экспериментах
с
рекомбинантным белком PII Arabidopsis in vitro было показано ингибирующее
действие на активность хлоропластной АССазы в присутствии АТФ, которое
полностью снималось в присутствии 2-ОГ, пирувата или оксалоацетата. Было
продемонстрировано, что PII снижает максимальную скорость АССазной реакции
без изменения Km для ацетил-СоА (Feria Bourrellier et al., 2010).
Что касается регуляции самого белка PII у растений, были показаны
флуктуации в уровнях мРНК при различных условиях освещения, что указывает
на возможную регуляцию на уровне транскрипции (Jiang и Ninfa, 2007; Uhrig et
al., 2009). Кроме того, на уровни мРНК помимо светового режима также
35
оказывали влияние уровни сахаров (увеличение экспрессии) и аминокислот
(снижение экспрессии) в клетке.
В недавних исследованиях было выявлено участие PII в регуляции
поглощения NO2- хлоропластами у A. thaliana (Ferrario-Mery et al., 2008). Сходные
данные были получены для цианобактерий, где было обнаружено, что PII
контролирует транспортер NO2- /NO3-. Однако у эукариотических фототрофов
гомолога транспортера обнаружено не было. Регуляторные эффекты PII на
поглощение хлоропластами NO2- зависят как от метаболического, так и
энергетического статуса клетки (Ferrario-Mery et al., 2008).
Также для A. thaliana была показана тканеспецифическая экспрессия PII.
Хотя только минорные изменения наблюдаются в уровнях транскрипции PII
развивающихся листьев, значительное 10-кратное повышение транскрипции было
зафиксировано на ранних и средних стадиях развития семян. По-видимому, PII у
растений также участвует в регуляции запасания белков в семени, хотя детали
этого процесса еще предстоит выяснить (Uhrig et al., 2009).
* * *
Обобщая имеющийся в литературе материал, следует отметить, что
представители семейства PII-белков высоко консервативны по своей структурной
организации и обнаружены во всех трех доменах жизни – у архей, бактерий и
фотосинтезирующих эукариот. Сигнальные белки PII участвуют в регуляции
метаболизма азота путем белок-белковых взаимодействий с широким набором
мишеней, таких как белки-транспортеры, регуляторы транскрипции и ферменты.
Ключевые составляющие путей ассимиляции азота в клетках сходны у многих
организмов, однако детали регуляции могут существенно отличаться. В клетках
прокариот
роль
координаторов
и
центральных
регуляторов
процессов
метаболизма азота и углерода выполняют сигнальные белки из семейства PII.
Кроме
того,
имеющиеся
экспериментальные
данные
указывают
на
36
непосредственное участие белков PII в восприятии энергетического статуса
клеток.
На протяжении многих лет большая часть исследований была посвящена
выяснению роли PII-белков у гетеротрофных прокариот, тогда как только в
последние годы достигнуты некоторые успехи в изучении функций РII-белков у
цианобактерий
и
некоторых
высших
растений.
Несмотря
на
высокую
консервативность структуры представителей этого семейства обращает внимание
разнообразие мишеней и, как следствие, спектр выполняемых функций в клетках
разных организмов. Показано, что у PII-белков организмов с оксигенным типом
фотосинтеза появились дополнительные клеточные мишени: наиболее изученной
у них консервативной функцией белков PII является контроль биосинтеза
аргинина за счет регуляции фермента N-ацетил-L-глутаматкиназы (NAGK).
Несмотря на некоторые важные различия в деталях обращает внимание
поразительное функциональное сходство взаимодействия NAGK-PII между
различными
доменами
жизни.
Подобная
консервативность
регуляции
аргинин/орнитинового пути биосинтеза у фотосинтезирующих организмов
свидетельствует о сильном эволюционном давлении отбора в пользу сохранения
взаимодействия NAGK-PII. Более того, представляется вероятным, что в ходе
эволюционного развития организмов произошла смена функций белка PII – от
центральной в координации процессов метаболизма азота и углерода у прокариот
к более узко специализированной в регуляции биосинтеза аргинина и жирных
кислот в хлоропластах высших растений. На сегодняшний день имеется
значительный
пробел
фотосинтезирующих
в
понимании
эволюционного
перехода
от
прокариот (цианобактерии) к высшим эукариотам
(растения), заполнить который помогут исследования структуры и функции
белков PII в клетках одноклеточных зеленых водорослей. Кроме того,
характерной особенностью PII-белков растений является наличие С-концевого
удлинения в 13-19 аминокислот. В связи с этим возникал вопрос об
эволюционном происхождении этого С-концевого участка и его функциональном
значении. Для изучения вышеупомянутых проблем в работе использованы
37
одноклеточные зеленые водоросли Chlamydomonas reinhardtii и Chlorella
variabilis, метаболизм которых достаточно хорошо изучен и для которых
разработаны методы генетического и молекулярно-биологического анализа.
38
ГЛАВА 2. МАТЕРИАЛЫ И МЕТОДЫ
2.1. Объекты исследования и условия культивирования
Использованный в работе штамм Chlamydomonas reinhardtii СС-124
(nit1agg1mt-) любезно предоставлен проф. Э. Харрис (Коллекция Культур
Chlamydomonas Университета г. Дюк, США); штамм Chlamydomonas reinhardtii
CF59 (lrg6) с независимым от света гаметогенезом любезно предоставлен проф.
С. Бэк (г. Фрайбург, Германия); штаммы дикого типа дикого типа 6145с и 621mt+
любезно предоставлены профессорами Э. Фернандесом (Испания) и С. Пуртоном
(Англия), соответственно. Chlamydomonas reinhardtii выращивалась в среде ТАР
(Gorman и Levine, 1965) следующего состава (мл/л): раствор Бейринка (NH4CI –
15 г/л; К2НРO4 – 0.2 г/л; Mg2SO4·7H2O – 4.0 г/л) – 100; фосфатный буфер
(К2НРO4 – 7.17 г/л, КН2РO4 – 3.63 г/л) – 100; Трис-ацетат – 20; микроэлементы
(ZnSO4·7H2O – 0.022 г/л; MnSO4 – 1.81 г/л; CuSO4·5H2O – 0.079 г/л; CoCl2 – 1.2
г/л; NаВО3·4Н2O – 2.63 г/л; (NH4)6Mo7O24·4H2O – 1 г/л;FeSO4·7H2O – 9.3 г/л;
Са(NО3)2 – 0.02 г/л; ЭДТА (трилон В) – 10 г/л) – 1 (pH среды 7,0). В
экспериментах использовались культуры, выращенные синхронно в режиме
освещения люминесцентными лампами 12 ч свет : 12 ч темнота при 23°С
(освещенность ~ 30 μmol m-2 s-1). Для опытов культуры пересевались каждые 72
часа.
Штамм Chlorella variabilis NC64A был любезно предоставлен проф. ВанИттеном (Университет г. Небраска-Линкольн, США). Chlorella variabilis
выращивалась в среде MBBM (Van Etten et al., 1983; Nichols и Bold, 1965)
следующего состава (мл/л): CaCl2 (2.5 г/л)– 10, MgSO4(7.5 г/л)– 10, K2HPO4 (7.5
г/л) – 10, KH2PO4 (17.5 г/л) – 10, NaCl (2.5 г/л) – 10, EDTA (50 г/л)+KOH (31 г/л)–
1, FeSO4 (4.98 г/л) – 1, H3BO3(11.42 г/л) – 1, микроэлементы (ZnSO4·7H2O – 8.82
г/л, MnCl2·4H2O – 1.44 г/л, MoO3– 0.71 г/л, CuSO4·5H2O – 1.57 г/л, Co(NO3)2·6H2O
– 0.49 г/л) – 2. Культивирование проводили на свету (~ 30 μmol m-2 s-1) с
постоянном покачиванием при температуре 25°C. Скорость роста определялась
при выращивании на средах с разными источниками азота: среда BBM (MBBMN), содержащая NH4Cl (25 мM), аргинин (2, 10 или 15 мM) или глутамин (2, 10
39
или 15 мM). Количество клеток оценивалось с использованием камеры Горяева.
Скорость роста определялась как число клеточных удвоений в час. Размеры
клеток
определись
микроскопически
(Leica
TCS-SP5,
Leica-Microsystems,
Германия) с использованием программного обеспечения Leica Application.
2.2. Получение прегамет и гамет Chlamydomonas reinhardtii
Для получения прегамет (незрелых гамет) вегетативные клетки переносили в
среду TAP-N в начале световой фазы культивирования, и инкубировали 24 часа в
темноте. Гаметы получали путем освещения прегамет в течение 2 ч.
Определение процента образовавшихся гамет проводили путем смешивания
исследуемых
гамет
с
гаметами
штамма-тестера противоположного
типа
спаривания в соотношении 1:3; через 1 ч инкубации клетки фиксировали
добавлением
0,5%
глутарового
альдегида.
Количество
двух-
и
четырехжгутиковых клеток подсчитывали под микроскопом. Процент зрелых
гамет, способных к формированию зигот, рассчитывали по формуле (Beck и Acker
1992):
1
a  100
%
B  2Q
Q
где
Q
–
количество
четырехжгутиковых
клеток;
B
–
количество
двухжгутиковых клеток; a – коэффициент, определяемый как отношение
количества тестируемых гамет к общему количеству гамет.
2.3. Определение концентрации хлорофилла
Для
определения
концентрации
хлорофилла
0,6
мл
культуры
центрифугировали (3 мин, 5000g) и ресуспендировали в 80% ацетоне, затем
перемешивали на вортексе и центрифугировали (5 мин, 12000g). Поглощение
супернатанта измеряли при длине волны 652 нм. В случае Chlorella variabilis для
полной экстракции пигментов был введен дополнительный этап разрушения
циркониево-кремниевыми шариками (диаметр 0,1 и 0,5 мм) на гомогенизаторе
40
Minilys (Bertin Technologies, Франция). Концентрацию хлорофилла (мг/мл)
рассчитывали по описанной ранее формуле (Arnon, 1949):
С = A652/34.5
2.4. Выделение тотальной РНК
30
мл
суспензии
клеток
Chlorella
или
Chlamydomonas
осаждали
центрифугированием (5000g, 5 мин), ресуспендировали в 0,5 мл тризола (Trizol,
Invitrogen, США) и перемешивали. Клетки Chlorella подвергали дополнительному
разрушению циркониево-кремниевыми шариками (диаметр 0,1 и 0,5 мм) с
использованием
Minilys
(Bertin
Technologies,
Франция).
Гомогенизат
инкубировали 5 мин при 20°C, добавляли 0,1 мл хлороформа, встряхивали 15 сек
и вновь инкубировали 5 мин при 20°C. Смесь центрифугировали (12000g, 4°C, 15
мин), верхнюю водную фазу отбирали в новую пробирку и добавляли 0,25 мл
изопропилового спирта. Инкубировали 10мин при 20°C, далее центрифугировали
(12000g, 4°C, 15 мин). Супернатант удаляли, к осадку добавляли 0,5 мл 75°
этанола, перемешивали и центрифугировали (7500g, 4°C, 5 мин). Осадок
высушивали и растворяли в DEPC (Diethylpyrocarbonate) (Amresco, США) воде.
РНК хранили при -70°C.
2.5. Метод ПЦР, OT-ПЦР и ПЦР в режиме реального времени
В состав реакционной смеси ПЦР объемом 25 мкл входили следующие
компоненты:
0,2
μМ
каждого
праймера;
40μМ
смеси
дезоксинуклеозидтрифосфатов; 0,5 ед. Taq ДНК-полимеразы (СибЭнзим, Россия)
(0,1мкл); 0,4 мкл ДНК; 2,5 мкл реакционного буфера. Условия реакции:
денатурация ДНК (95°C, 5 мин); 39 циклов, состоящих из денатурации ДНК
(95°C, 30 с), отжига праймеров (55-65°C, 30 с), синтеза цепи ДНК (72°C, 1 мин);
дополнительный
синтез
визуализировали
с
ДНК
помощью
(72°C,
3
мин).
электрофореза
в
Продукты
ПЦР-реакции
1,5%-агарозном
геле
с
использованием бромистого этидия. Анализ гелей проводился с помощью
оптической системы GelDoc (Upland, США).
41
Одноцепочечная кДНК была получена на матрице РНК с использованием
набора для обратной транскрипции (RevertAid H Minus First Strand cDNA
Synthesis Kit, ThermoScientific, США) согласно рекомендациям производителя.
Перед синтезм кДНК РНК обрабатывали ДНКазой I (ThermoScientific, США)
(37°C, 15 мин). Инактивировали ДНКазу I нагреванием (80°C, 10 мин). Все
использованные в работе праймеры для количественной ПЦР в режиме реального
времени давали эффективность реакции ≥90% и единственный пик на кривой
плавления (таблица 1). Каждая реакция содержала 0,2 μМкаждого праймера;
40μМ смеси дезоксинуклеозид трифосфатов; 2,5 мкл реакционного буфера; 2,5
мМ MgCl2; 0,1 ед. HotTaq ДНК-полимеразы (СибЭнзим, Россия); 5 % DMSO; 1,25
мкл SYBRGreenI; 200-300 мкг кДНК. Количественная ПЦР врежиме реального
времени выполнялась на термоциклере LightCycler (CFX96 Real-Time PCR
Detection System, BioRad, США) с использованием SYBRGreenI в качестве
флюоресцентного красителя. Условия реакции: денатурация ДНК (95°C, 3 мин);
39 циклов, состоящих из денатурации ДНК (95°C, 30 с), отжига праймеров (5565°C, 30 с), синтеза цепи ДНК (72°C, 1 мин). Все реакции были выполнены в трех
повторах на пробах из, как минимум, двух биологических выделений. Контроли
без матрицы или обратной транскрипции были включены. Значение Ct
определялось как номер цикла, на котором флюоресцентный сигнал реакции
пересекает базовую линию, с использованием программного обеспечения
CFXManager. Относительная разница уровней экспрессии генов вычислялась по
формуле:
Δ = 2-(Ctопыт-Ctконтроль)
Для статистической обработки полученных данных использовался пакет
офисных программ MicrosoftExcel.
Таблица 1. Последовательности праймеров для амплификации.
Праймер
CrGLB1 прямой
Последовательность (5'-3')
GGCGTCAAGTTCTTCCGCAT
42
CrGLB1 обратный
GGTTGGAGGGACCGAACTCA
CrUBI прямой
GTACAGCGGCGGCTAGAGGCAC
CrUBI обратный
AGCGTCAGCGGCGGTTGCAGGTATCT
CrAMT1;1 прямой
GCACGGGAGGGCAAGAGGTTC
CrAMT1;1 обратный
ATGTGCCGCAGTCAAGAAGGATTT
CvGLB1F6 прямой
CATACGCGGCATGACTGTG
CvGLB1R6 обратный
GCCTTCTCCACCAGGAACTG
CvUBI прямой
GGCGTGGAGAAAGGACAAGC
CvUBI обратный
GGATGTAGCACTTCCACCGC
CvAMT1 прямой
GGCTTCTTTGCAACACAGACC
CvAMT1 обратный
CAGCACCAGAAACATTCCCGC
CvEF1A прямой
GCGACAGACAGGACACAATGG
CvEF1A обратный
CGAAGGAAGACTTGCCCAGG
CvGPD1 прямой
GCGCAGACATGTTTGTGGG
CvGPD1 обратный
CGGCAATCAGCTTGACAGC
CvMDH3 прямой
CGCAAAGTCGCCGTACTAGG
CvMDH3 обратный
GCCTTGCTGTTGATGTGGC
CvPYK прямой
AGTGGCCAAGACCAAGATCG
CvPYK обратный
GTGCGGTGGTACTCAATGGG
CvCBLP прямой
ACACCAAGGACGTGCTGTCG
CvCBLP обратный
CGATCGTGTACTTGCACTCGC
CvACT прямой
TGTTGTGGTCGTGGATCTTGG
CvACT обратный
TCCTTCGTGTCCAGCATTGC
43
CvGLB1F3 прямой
AGTTGGGTGCAGCTTCTCG
CvGLB1F3 обратный
CTGCTAGGGCTTGCCTGAC
CvGLB1F4 прямой
CTGCACGTCTGCAACTCG
CvGLB1F4 обратный
CTCCACCCGGAAGAAGTTG
CvGLB1F5 прямой
ATGACTGTGTCGGACGTCAA
CvGLB1F5 обратный
ATCTTTCCGTCCCCGATCT
2.6. Клонирование и секвенирование ДНК-фрагментов
Для изоляции геномной ДНК 30 мл культуры клеток Chlorellа из
логарифмической
фазы
роста
центрифугировали
(5000g,
5
мин)
и
ресуспендировали в лизирующем буфере (50 мMтрис-HCl (pH 7.5), 300 мM NaCl,
10 мM ЭДТА, 4% SDS). Клетки Chlorella разрушали циркониево-кремниевыми
шариками (0,1 и 0,5 мм) с использованием Minilys (BertinTechnologies, Франция).
Этапы ПЦР и последовательности праймеров для выявления недостающей
последовательности гена CvGLB1 приведены на рисунке 18 в разделе 3. ПЦРамплификация выполнялась по описанной ранее методике (Liu et al., 1995).
Специфические ПЦР-продукты изолировали из агарозного геля с использованием
набора для экстракции ДНК (QIAquick Gel Extraction kit, QIAGEN, Германия),
клонировали в вектор для клонирования ПЦР-продуктов pAL-TA (Евроген,
Россия) и трансформировали в клетки E. coli DH5α. Секвенирование ДНКфрагментов проводили с использованием стандартных для pAL-TA праймеров с
использованием набора для секвенирования (BigDye (R) Terminator v3.1 Cycle
Sequencing Kit, LifeTechnologies, США) на автоматическом секвенаторе (модель
3500xL Genetic Analyzer, LifeTechnologies, США). Все реакции секвенирования
были
выполнены
на
базе
ресурсного
центра
Санкт-Петербургского
государственного университета.
Размер соответствующих фрагментов кодирующей последовательности
CvGLB1 проверяли на матрице кДНК с использованием пар праймеров
44
GLB1F3/GLB1F3 (размер ПЦР-фрагмента 71 bp), GLB1F4/GLB1F4 (120 bp),
GLB1F5/GLB1F5 (203 bp). Последовательности праймеров приведены в таблице 1.
Продукты ПЦР-реакции визуализировали с помощью электрофореза в 1-2%агарозном геле с использованием бромистого этидия. Анализ гелей проводился с
помощью оптической системы GelDoc (Upland, США).
2.7. Выделение тотального белка и определение его концентрации
30 мл суспензии клеток Chlamydomonas или Chlorella центрифугировали
(5000g, 5 мин) и ресуспендировали в 300 мкл буфера А (0,1 М DTT, 0.1M Na2CO3).
Затем добавляли 200 мкл буфера В (5% SDS, 30% сахарозы). Гомогенизировали
образцы путем перемешивания на вортексе в течение нескольких минут. Клетки
Chlorella подвергали дополнительному разрушению циркониево-кремниевыми
шариками (диаметр 0,1 и 0,5 мм) с использованием Minilys (Bertin Technologies,
Франция). Концентрацию экстрагированного белка определяли методом с
амидочерным (Popov et al., 1975). Для построения калибровочной кривой
использовали растворы БСА с известными концентрациями.
2.8. Вестерн-блоттинг
Разделение
белков
проводилось
методом
электрофореза
в
12-15%
полиакриламидном геле (ПААГ) с SDS (Laemmli, 1970) (90 мин, 100V). С ПААГ
белки переносились на нитроцеллюлозную мембрану (KarlRoth) полусухим
методом с использованием системы Транс-блот (BioRad, США) (60 мин, 20V).
Неспецифическое связывание антител с мембраной блокировалось путем
инкубации в 5% обезжиренном сухом молоке (в TBS буфере) при постоянном
перемешивании в течение 1ч. Далее проводилась гибридизация с первичными
антителами в течение 2ч. В работе использовались специфичные первичные
антитела к CrPII, α-CGE1, HSP70B, NAB1 (Agrisera, Швеция), AOX1(Agrisera,
Швеция). Антителак CrPII были получены Pineda Antikörper-Service (Берлин,
Германия). Специфические антитела к α-CGE1 и HSP70B любезно предоставлены
доктором М. Шрода (Институт молекулярной физиологии растений общества
45
Макса Планка, Потсдам, Германия). В работе использовали следующие
разведения антител: 1:5000 анти-CrPII, 1:10000 анти-NAB1, 1:10000 анти-AOX1,
1:10000 анти-HSP70B, 1:6000 анти-α-CGE1. На следующем этапе мембрана
подвергалась гибридизации в течение 1ч с вторичными антителами кролика,
конъюгированными с пероксидазой хрена (Sigma, США) (разведение 1:10000).
Детекцию
пероксидазной
активности
проводили
с
использованием
хемилюминисцентного субстрата (Roche, Германия). Для регистрации сигнала
использовали рентгеновскую пленку (Kodak, США).
2.9. Изоляция хлоропластов из клеток Chlamydomonas reinhardtii
Изоляцию хлоропластов проводили по описанной ранее методике (Klein et
al., 1983). Клетки Chlamydomonas reinhardtii, предварительно обработанные
автолизином, для удаления клеточной стенки, инкубировали с 0,004% (w/v)
дигитонином (Sigma, США) в растворе лизирующего буфера (5 мМ K-фосфатный
буфер (pH 6,5), 6% PEG (w/w), 4 мг/мл БСА) и прогревали при 40°С в течение 1
мин. Хлоропласты отбирали после градиентного центрифугирования из зоны,
расположенной на границе 45 и 70% перколла. Затем полученные хлоропласты
ресуспендировали в лизирующем буфере и обрабатывали как целые клеточные
экстракты.
Для получения автолизина клетки штаммов 620 (mt-) и 621 (mt+) выращивали
в среде TAP, после чего для индукции гаметогенеза клетки ресуспендировали в
среде TAP-N без азота и инкубировали 24 ч при постоянном освещении. Гаметы
противоположных
типов
спаривания
смешивали,
концентрировали
центрифугированием (5 мин, 5000g) до концентрации ~3х107 кл/мл и
инкубировали 1 час на свету. После этого клетки осаждали центрифугированием
(5 мин, 5000g), а супернатант с автолизином отфильтровывали через мембранный
фильтр с диаметром пор 0,2 мкм (Millipore, США). Для проверки качества
полученного фермента, к 1х107 кл/мл добавляли 50 мкл автолизина и
инкубировали 30 мин. После чего клетки лизировали путем добавления 50 мкл
0,5% Тритона Х-100, и определяли процент разрушенных клеток в камере Горяева
46
под микроскопом. В опытах использовали препараты, которые приводили к
лизису 90% клеток.
2.10. Определение активности глутаминсинтетазы (GS)
Cуспензию клеток Chlorella (20 мкг хлорофилла) центрифугировали (3000g,
5 мин) и ресуспендировали в 0,8 мл раствора 1 (HEPES 66.7 мM (pH 7.0), Lглутамин 40 мМ, MnCl2 4 мM, АДФ 0.5 мM). Замораживали на 10 мин (-70°С).
После размораживания вносили 0,1 мл свежеприготовленного раствора 2
(1.2М:1.2М гидроксиламин хлорид:NaOH) перемешивали на вортексе в течение
10 с. Далее вносили 50 мкл раствора 3 (Na2HAsO4*7H2O 124,8 мг/мл),
перемешивали на вортексе и инкубировали суспензию на свету при 30°С
в
течение 10 мин. После этого добавляли 2 мл раствора 4 (37% HCl 3.87 ml, ТХУ 6
г, FeCl3*6H2O16.65 г, вода до 500 мл), центрифугировали (10 мин, 10000g) и
измеряли поглощение при
A550 на спектрофотометре (BioRad, США).
Активность глутаминсинтетазы (мкмоль/мин*мг хлорофилла) вычисляли по
формуле (Shapiro и Stadtman, 1970):
Активность GS =A540/(0,32*Хл*t),
где A540 – длинаволны,
Хл – количество хлорофилла (мг),
t – время инкубации (мин)
2.11. Определение внутриклеточного содержания свободного аргинина
Внутриклеточный аргинин экстрагировался водой в течение 20 мин при
95°C и анализировался в супернатанте после центрифугирования (12000g, 5 мин).
Общее количество свободно аргинина измеряли по описанной ранее методике
(Sakaguchi, 1950). 100 мкл 0,2% 8-гидроксихинолина и 100 мкл 2M NaOH
добавляли к супернатанту, затем реакционную смесь инкубировали 10 минут на
льду. После добавления 100 мкл 19% гипохлорита натрия и перемешивания на
вортексе в течение 30 с реакцию останавливали добавлением 100 мкл 40%
мочевины. Абсорбцию измеряли при длине волны 500 нм. Количество аргинина
47
определяли по калибровочной кривой, построенной с использованием водных
растворов чистого аргинина (Sigma, США) в диапазоне концентраций 10-200
мкг/мл.
2.12. Определение содержания глутамата в среде
Использованный энзиматический метод определения глутамата в среде
основан на изменении поглощения при длине волны 340 нм в результате
восстановления НАД+ до НАДН в ходе дегидрогеназной реакции окисления
глутамата.
В
экспериментах
использовался
набор
для
определения
глутамина/глутамата согласно рекомендациям производителя (Sigma, США).
Клетки, выращенные на среде с 10 mM глутамина, в экспоненциальной и
стационарной фазах роста центрифугировали, а полученный супернатант
использовали для измерения содержания глутамата. В качестве контроля
использовалась свежая среда с 10 мМ глутамина.
2.13. Клонирование, экспрессия и очистка рекомбинантных белков
Рекомбинантные белки PII Chlorella variabilis (CvPII), Physcomitrella patens
(PpPII), Oryza sativa (OsPII) были получены с использованием синтетических
генов с оптимизированным набором
кодонов для экспрессии
в E.coli
(Geneart/LifeTechnologies, Германия; MWG Eurofins GmbH, Германия). Для
экспрессии белка СvPII в клетках E.coli была использована последовательность
гена СvGLB1 (Minaeva и Ermilova, 2015), соответствующая зрелому белку PII без
транзитного пептида хлоропластной локализации (начиная с 48 аминокислоты).
Последовательности
ДНК
были
получены
из
аминокислотных
последовательностей зрелых, локализованных в хлоропластах, белков OsPII
(BAF16476.1) и PpPII (BAF36548.1), начиная с аминокислот 69 и 60,
соответственно. Синтетический ген CvPII был амплифицирован с использованием
пары
праймеров
5-GAAATGAATAGTTCGACAAAAATCTAGATAACGA
GGGCAAAAAATGTGCAACTCGGGCAGCAACGG-3 и 5-AGCTTATTATTTTTC
GAACTGCGGGTGGCTCCAAGCGCTGAGCACCCCCTTGATCCCAGTCATG-3.
48
Синтетический ген OsPII был амплифицирован с использованием пары праймеров
5'-AATAGTTCGACAAAAATCTAGATAACGAGGGCAAAAAATGGCCCAATCT
GCAGCCGCTGС-3' и 5'-AAGCTTATTATTTTTCGAACTGCGGGTGGCTCCAA
GCGCTACTAATTGGCATAGCACTGC-3'.
амплифицирован
с
использованием
Синтетический
праймеров
ген
был
PpPII
5'-AATAGTTCGACAAAA
ATCTAGATAACGAGGGCAAAAAATGGTTGCCTCTGCGAGCGATCС-3 'и 5'AAGCTTATTATTTTTCGAACTGCGGGTGGCTCCAAGCGCTGTTCCCATCTGA
GCCTTCCGC-3’. ПЦР продукты были клонированы в вектор pASK-IBA3plus
(IBA GmbH, Германия), разрезанный по сайтам рестрикции NcoI и SacII, с
использованием
изотермального
метода
сборки
множественных
последовательностей по Гибсону (Gibson et al., 2009). Полученные конструкции
PII-белков трансформировали в клетки E.coli штамм RB9060 с делецией по PIIбелку
(Bueno
et
al.,
Индуцировали
1985).
экспрессию
PII-белков
со
стрептавидиновым тагом из восьми аминокислот (TrpSerHisProGlnPheGluLys) на
С-конце (Strep-tagII) добавлением 0,2 мМ ангидротетрациклина к суспензии
клеток E.coli с оптической плотностью 0,5 единиц в течение ночи при постоянном
покачивании (200 об/мин, 20°С). Очистку рекомбинантных PII-белков со
стрептавидиновыми
тагами
без
последовательностей
соответствующих
транзитных пептидов (StrepCrPII-tp, StrepCvPII-tp, StrepPpPII-tp, StrepOsPII-tp) до
близкой электрофоретической гомогенности проводили с использованием метода
аффинной хроматографии на колонке с иммобилизованной Strep-tactin агарозой
(IBA GmbH, Геттинген, Германия) как это было описано ранее (Heinrich et al.
2004).
Рекомбинантный белок NAGK одноклеточной зеленой водоросли Chlorella
variabilis
был
получен
оптимизированным
с
набором
использованием
кодонов
для
синтетического
экспрессии
гена
в
с
E.coli
(Geneart/LifeTechnologies, Германия). Последовательность ДНК CvNAGK была
получена на основе аминокислотной последовательности зрелого белка,
локализованного в хлоропласте, начиная с аминокислоты 48. Синтетический ген
CvNAGK
был
амплифицирован
с
использованием
пары
праймеров
5-
49
ATCATCATCATCACAGCAGCGGCCTGGTGCCGCGCGGCAGCGCGCCGCAAG
CCTCCAAGGC-3
и
5-TTCCTTTCGGGCTTTGTTAGCAGCCGGATCCTCGAG
CATATGTTATAGGGGCCGCTCACATATC-3. ПЦР продукт был клонирован в
вектор pET15b (Novagen, Германия) по сайту рестрикции NdeI с использованием
стратегии клонирования по Гибсону (Gibson et al., 2009). Полученную
конструкцию
CvNAGK,
соответствующую
последовательности
белка
без
транзитного пептида с тагом из шести гистидинов на N-конце (His6CvNAGK-tp),
трансформировали в клетки E.coli штамм Rosetta (Novagen, Германия).
Индуцировали экспрессию добавлением 0,1 М IPTG к суспензии клеток E. coli с
оптической плотностью 0,5 единиц в течение ночи при постоянном покачивании
(200 об/мин, 20°С). Очистку CvNAGK до близкой электрофоретической
гомогенности проводили с использованием метода аффинной хроматографии на
колонке с иммобилизованной Ni-NTA агарозой (IBA GmbH, Германия) как это
было описано ранее (Maheswaran et al., 2004).
Рекомбинантный белок AtNAGK с шестью гистидинами на N-конце без
последовательности транзитного пептида (His6AtNAGK-tp) был экспрессирован и
очищен как описано ранее (Beez et al., 2009).
2.14. Гель-фильтрация
Для определения олигомерного состояния белков PII и NAGK, а также
анализа характера их взаимодействия был использован метод эксклюзионной
хроматографии (гель-фильтрации). Аликвоты белков (10 мкл с концентрацией 1-3
мкг/мкл) центрифугировали при 14000 об/минв течение 3 мин, а затем
хроматографировали на колонке Superdex 200 10/300 GL (Amersham Biosciences,
Германия) с использованием системы AKTA micro (GE Healthcare LifeSciences,
Германия) при комнатной температуре. Предварительно колонку уравновешивали
рабочим буфером следующего состава: 10 мМ Трис рН 7,8, 300 мМ NaCl, 1 мМ
ДТТ, 2 мМ MgCl2, 20 мкМ Arg, 0,02% NaN3, и 2% глицерина. Скорость потока
составляла 0.05 мл/мин. Профиль элюции белка (или смеси белков) фиксировался
50
с помощью УФ-детекциипри длине волны 280 нм и анализировался с помощью
программного обеспечения UniCorn5 (GE Healthcare LifeSciences, Германия).
Колонка Superdex 200 10/300 GL калибровалась с использованием
стандартных
наборов
белков
с
известными
молекулярными
массами:
тироглобулин (670 кДа), альдолаза (158 кДа), кональбумин (75 кДа), овальбумин
(44 кДа), карбоангидраза (29 кДа), миоглобин (17.5 кДа), рибонуклеаза A (13.7
кДа) и апротинин (6.5 kDa).
Для анализа действия молекул-эффекторов на формирование комплекса
CvPII-CvNAGK использовался метод кросс-линкинга с глутаровым альдегидом.
Белки PII (1 мкг/мкл) и NAGK (1.5 мкг/мкл) в PBS-Mg буфере подвергались
действию
глутарового
альдегида
(0.1%)
в
течение
3
мин
при
37°С,
центрифугировали (14000 об/мин, 3 мин) и хроматографировали как описано
выше. Смесь белков PII-NAGK инкубировалась с эффекторными молекулами
(Gln, 2-ОГ, ATФ) в течение 5 минут до реакции кросс-линкинга.
2.15. Метод оценки активности фермента NAGK
Активность очищенных рекомбинантных белков NAGK была измерена в
сопряженных ферментативных реакциях: ATФ-зависимое фосфорилирование
NAG через пируваткиназу и лактатдегидрогеназу с последующим окислением
НАДН (Beez et al., 2009). Реакционная смесь содержала 50 мМ имидазола рН 7.5,
50 мМ KCl, 20 мМ MgCl2, 0,4 мМ НАДН, 1 мМ фосфоенолпирувата, 10 мМ АТФ,
0,5 мМ ДТТ, 11 U лактатдегидрогеназы, 15 U пируваткиназы и 50 мМ NAG. При
необходимости в реакционную смесь добавляли 2,4 мкг белка PII и реакцию
запускали добавлением 3 мкг NAGK, если не указано иное. Реакция
фиксировалась в течение 10 мин с использованием спектрофотометра SPECORD
200 (Analytik Jena, Германия) при 340 нм. Фосфорилирование одной молекулы
NAG пропорционально окислению одной молекулы НАДН, что регистрируется
как линейное уменьшение оптической плотности при длине волны 340 нм. Одна
единица NAGK катализирует превращение 1 мкмоль NAG в минуту с
рассчитанным с молярным коэффициентом поглощения НАДН ( 340 = 6178 L
51
моль-1 см-1). Средние значения трех экспериментальных определений были
приведены со стандартным отклонением <5%. Энзиматические параметры Км,
Kcat, Hillslope и IC 50 рассчитывали исходя из наклона кривой скорости реакции,
используя программное обеспечение GraphPad Prism-6.01 (GraphPad Software,
США).
52
ГЛАВА 3. РЕЗУЛЬТАТЫ
3.1. Характеристика белка PII Chlamydomonas reinhardtii (CrPII)
3.1.1. Биоинформационный анализ первичной последовательности CrPII
В геноме Chlamydomonas reinhardtii была выявлена полипептидная
последовательность предполагаемого белка PII, закодированная геном
GLB1.
Длина этого белка составляет 205 аминокислот, а его молекулярная масса 22070,40
дальтон.
У
всех
проанализированных
на
сегодняшний
день
цианобактерий и высших растений в геномах содержатся только GlnB-гомологи
PII, функции которых значительно отличаются от таковых у архей и
гетеротрофных бактерий (см. гл. 1). Был проведен сравнительный анализ
аминокислотной последовательности белка PII C. reinhardtii с первичными
последовательностями
соответствующих
белков
высших
растений
и
цианобактерий (рисунок 10).
I
Cr
At
Os
Sl
Sy
Sc
Ec
57
56
61
53
1
1
1
Cr
At
Os
Sl
Sy
Sc
Ec
137
132
141
129
58
58
58
RRAPYAELESIQCDLSAFPGVKFFRIEAIFRPWRLPFVIDTLSKYGIRGLTNTPVKGVGVQGGSRERYAGTEFGPSNLVD
----VLPVVSAQISSDYIPDSKFYKVEAIVRPWRIQQVSSALLKIGIRGVTVSDVRGFGAQGGSTERHGGSEFSEDKFVA
RLPPTAARAQSAAAAGYQPESEFYKVEAILRPWRVPYVSSGLLQMGIRGVTVSDVRGFGAQGGSTERHEGSEFAEDTFID
----SFPIIRAQNSPDFVPDAKFYKVEAILRPWRIQQVSSALLKMGIRGVTVSDVRGFGAQGGLTERQAGSEFSEDTFVA
----------------------MKKIEAIIRPFKLDEVKIALVNAGIVGMTVSEVRGFGRQKGQTERYRGSEYTVE-FLQ
----------------------MKKVEAIIRPFKLDEVKIALVNAGIVGMTVSEVRGFGRQKGQTERYRGSEYTVE-FLQ
----------------------MKKIDAIIKPFKLDDVREALAEVGITGMTVTEVKGFGRQKGHTELYRGAEYMVD-FLP
II
T-loop
KEKLDIVVSRAQVDAVVRLVAASAYTGEIGDGKIFVHPVAEVVRIRTAETGLEAEKMEGGMEDMMKKKK--KVKMEIVVKKDQVESVINTIIEGARTGEIGDGKIFVLPVSDVIRVRTGERGEKAEKMTGDMLSPS------KVKMEIVVSKDQVEAVVDKIIEKARTGEIGDGKIFLIPVSDVIRIRTGERGERAERMAGGLADKLSSAMPIS
KVKMEIVVSKDQVEGVIAKIIEEARTGEIGDGKIFLTPISDVIRVRTGERGEKAERMMGGHADMSSALSTSKLKLEIVVEDAQVDTVIDKIVAAARTGEIGDGKIFVSPVDQTIRIRTGEKNADAI----------------KLKIEIVVDEGQVDMVVDKLVSAARTGEIGDGKIFISPVDSVVRIRTGEKDTEAI----------------KVKIEIVVPDDIVDTCVDTIIRTAQTGKIGDGKIFVFDVARVIRIRTGEEDDAAI-----------------
Рисунок 10. Сравнительный анализ аминокислотных последовательностей PII-белков
C.reinhardtii, растений и бактерий. Chlamydomonas reinhardtii (Cr; XP_001703658.1), Arabidopsis
thaliana (At; NP_192099.1), Oryza sativa Japonica (Os; NP_001054562.1), Solanum lycopersicum
(Sl; AAR14689.1), Synechococcus PCC 7942 (Sy; P0A3F4.1), Synechocystis sp. PCC 6803 (Sc;
CAA66127.1), E. coli (Ec; AP_003139.1). Выделенные черным остатки консервативны у 60%
анализируемых PII-белков. Блоки I и II обозначают две консервативные последовательности
субсемейства GlnB, PS00496 и PS00638. Белыми и черными стрелками обозначены позиции
тирозиновых оснований, подвергающихся уридилированию в белке PII E. coli, и сериновых
оснований, фосфорилируемых у Synechoccocus PCC 7942, соответственно. АТФ-связывающие
основания отмечены черными кружками. Выравнивание последовательностей проводилось с
помощью программного обеспечения ClustalW.
53
Область
гомологии
последовательность
прокариотическим
бактериального
белкам
белка
PII
и
включает
находится
полную
между
аминокислотами 82 и 183 белка PII C. reinhardtii (CrPII). Общая идентичность
последовательностей в этой области белков CrPII и PII E. coli составляет 48,5%.
Кроме
того,
высокая
степень
сходства
в
пределах
этого
региона,
соответствующего PII E. coli, также была выявлена для последовательностей glnBгенов высших растений и цианобактерий, таких как Arabidopsis thaliana (53,5 %),
Oryza sativa Japonica (40,3 %), Solanum lycopersicum (39,0 %), Synechococcus PCC
7942 (53,5 %), Synechocystis sp. PCC 6803 (52,0 %). Помимо высокого процента
идентичности всей аминокислотной последовательности между различными PIIбелками цианобактерий, растений и C. reinhardtii, были выявлены два
характерных паттерна PROSITE с особо высоким сходством последовательностей
(PS00496 и PS00638).
У многих бактерий, как уже отмечалось в гл. 1, PII-белки регулируются
путем ковалентной модификации по консервативным основаниям. Так, например,
у
протеобактерий
PII
подвергается
обратимому
уридилированию
по
специфическому основанию тирозинана Т-петли в положении 51 (Tyr-51), тогда
как у некоторых цианобактерий этот белок может быть фосфорилирован по
сериновому основанию (Ser-49), локализованному на расстоянии двух оснований
от Tyr-51 протеобактерий (Forchhammer и Tadeau de Marsac, 1994). Несмотря на
то, что PII-белки растений остаются консервативными по наличию основания Ser49, они не подвергаются модификации путем фосфорилирования (Smith et al.,
2004). У C. reinhardtii соответствующая позиция занята треонином, который тоже
не исключает возможности фосфорилирования. Однако было показано, что белок
PII C. reinhardtii также не фосфорилируется (Ermilova et al., 2013).
Стоит отметить, что консервативная последовательность В-петли в белке
СrPII содержит все необходимые основания для связывания АТФ между двумя
соседними субъединицами тримерного белка PII.
В белках PII растений было выявлено наличие неконсервативных N- и Сконцевых участков, отсутствующих у прокариотических белков PII (Uhrig et al.,
54
2009). Как и у высших растений, в состав неконсервативного N-концевого участка
CrPII
входит
последовательность
сигнального
пептида,
определяющего
хлоропластную локализацию (аминокислотные остатки с 1 по 46) (ChloroP Center
for Biological Sequence Analysis, Emanuelsson et al., 1999; Emanuelsson et al., 2007).
Этот предварительный анализ указывает на то, что как и его гомологи у высших
растений, PII C. reinhardtii локализован в хлоропласте.
3.1.2. Иммунологическая идентификация CrPII
Иммунологическая идентификация СrPII проводилась с использованием
поликлональных антител к зрелому белку с С-концевой меткой StrepII (StrepCrPIItp), синтезированному в мутантном штамме E. coli RB9060 (с делецией по гену
glnB) (Bueno et al., 1985). Поскольку биоинформационный анализ показал
хлоропластную локализацию белка, это было проверено экспериментально
методом Вестерн-блоттинга. Как видно из рисунка 11, белок PII C. reinhardtii
может быть обнаружен в белковых экстрактах, полученных как из клеток, так и из
предварительно изолированных хлоропластов.
Молекулярная
последовательности
масса
кДНК
белка
GLB1,
CrPII,
рассчитанная
составляет
исходя
22070,40
Да.
из
Белок
соответствующего размера был обнаружен при анализе тотального клеточного
белка. Однако, как видно из рисунка 11, в препаратах, полученных из клеток,
детектируется также вторая полоса с молекулярной массой около 18 кДа. Следует
подчеркнуть,
что
вычисленная
на
основе
первичной
аминокислотной
последовательности молекулярная масса зрелого CrPII (без транзитного пептида)
составляет 17535,13 Да. Примечательно, что в изолированных хлоропластах
молекулярная масса белка, выявленного с помощью Вестерн-блоттинга,
действительно, составляет порядка 18 кДа, что указывает на то, что белок,
находящийся в хлоропласте, процессирован. Полученные данные подтверждают
локализацию зрелого белка CrPII в хлоропласте водоросли, что хорошо
согласуется как с данными биоинформационного анализа, так и с результатами по
локализации соответствующих гомологов, описанных ранее у растений.
Хлоропласты
Клетки
55
Рисунок 11. Определение субклеточной локализации белка PII. В качестве контроля
использовались антитела к белкам, локализованным в цитозоле (NAB1), хлоропласте (CGE1) и
митохондриях (AOX1).
3.1.3. Транскрипция гена CrGLB1, кодирующего белок CrPII
Экспрессия CrPII на разных этапах гаметогенеза. Ранее была показана
тканеспецифичная экспрессия гена, кодирующего PII у высших растений (см. гл.
1) (Uhrig et al., 2009). В связи с этим был проведен сравнительный анализ уровней
экспрессии гена CrGLB1 методом ПЦР в режиме реального времени в клетках,
находящихся на разных этапах жизненного цикла (вегетативных клетках,
прегаметах и гаметах) (рисунок 12А). Уровень транскрипции гена CrGLB1 не
повышается в прегаметах (22 ч в среде без азота в темноте) относительно
вегетативных клеток, тогда как в гаметах, полученных после освещения прегамет
в течение 2х часов, выявлено некоторое увеличение (в 3-4 раза) транскрипции
гена.
56
A
100
100
Относительная экспрессия
8
Lg
10000
Lg
10000
1
0,01
1
0,01
6
4
2
0
CC-124
lrg6
Б
CrPII
ВК
П
Г
ВК
П
Г
Рисунок 12. Экспрессия CrPII в вегетативных клетках, прегаметах и гаметах штамма дикого
типа СС-124 и инсерционного мутанта lrg6. Вегетативные клетки выращивались синхронно в
среде TAP (□), а затем были перенесены в среду TAP-N на 24 часа в темноту ( ). Гаметы были
получены в результате освещения прегамет в течение 2 часов (■).
А Уровни относительной экспрессии CrGLB1. В качестве положительного контроля действия
света и голодания по азоту использовался ген CrAMT1;1, экспрессии которого повышается в
ответ на действие этих факторов (вставки).
Б Оценка уровней белка CrPII в вегетативных клетках, прегаметах и гаметах методом Вестернблоттинга с использованием PII-специфичных антител.
Далее был поставлен вопрос: связан ли наблюдаемый световой контроль с
дифференциацией вегетативных клеток в гаметы? У C. reinhardtii гаметогенез
представляет собой двухэтапный процесс (Beck и Acker, 1992). Он инициируется
удалением аммония из среды, что приводит к формированию в темноте прегамет
(незрелых гамет), которые не способны к формированию пары с гаметами
противоположного
типа
спаривания.
Для
завершения
программы
дифференцировки прегамет в гаметы необходимо действие второго сигнала –
света. Чтобы разграничить гаметогенез и потенциально-возможное действие света
был использован инсерционный мутант lrg6, демонстрирующий гаметогенез
57
(Dame et al., 2002) и теряющий хемотаксис в отсутствие светового сигнала
(Ermilova et al., 2006). Характер экспрессии гена CrGLB1 у мутанта lrg6
определялся методом ПЦР в режиме реального времени в вегетативных клетках и
двух типах гамет: «темновых» и полученных после освещения последних в
течение 2 ч (рисунок 12А). Интересно, что уровень экспрессии этого гена у
мутанта lrg6 увеличивался только после освещения, тогда как для «темновых
гамет» оставался неизменным. Т.о., повышение уровней мРНК CrGLB1 после
освещения прегамет в течение 2 часов в клетках дикого типа, а также
инсерционного мутанта lrg6, указывает на то, что эти изменения не связаны с
процессом гаметогенеза.
Методом Вестерн-блоттинга были проанализированы уровни белка CrPII в
вегетативных клетках, прегаметах и гаметах обоих штаммов (рисунок 12Б).
Дополнительного увеличения уровней этого белка в гаметах выявлено не было, а
повышение уровней экспрессии за счет интенсификации транскрипции в 3 раза
(рисунок 12Б) остается за пределами разрешения данного метода.
Регуляция экспрессии
CrPII светом. Для более детального анализа
светового контроля уровней транскрипции гена CrGLB1 клетки C. reinhardtii
выращивались на среде ТАР в темноте в течение 72 часов, а затем подвергались
освещению белым светом в течение 30 мин, 2, 4, 6, 8 и 24 ч (рисунок 13А). Было
установлено, что уровень транскрипции гена CrGLB1 повышается в течение 2
часов освещения, достигая трехкратного увеличения, по сравнению с клетками,
выращенными
в
темноте.
При
дальнейшем освещении
клеток
уровень
транскрипции этого гена снижается. Методом Вестерн-блоттинга было показано,
что наблюдаемое увеличение не оказывает значительного воздействия на уровни
белка PII (рисунок 13Б).
В соответствии с полученными данными, можно заключить, что уровни
транскрипции и трансляции CrPII достаточно постоянны на свету и в темноте, за
исключением небольшого повышения транскрипции, наблюдаемого в ответ на
переноc клеток из темноты на свет.
58
Относительная экспрессия
A
Б
8
6
4
2
0
0
0.5
2
4
6
Темнота
Свет, ч
Темнота
Свет, ч
0
0.5
2
4
6
8
8
24
24
24
CrPII
Рисунок 13. Экспрессия CrPII в темноте и после освещения белым светом. Выращенные в
темноте вегетативные клетки штамма СС-124 освещались в течение 0,5; 2; 4; 6; 8 и 24 ч.
А Уровни относительной экспрессии CrGLB1.
Б Оценка уровней белка CrPII методом Вестерн-блоттинга с использованием PII-специфичных
антител.
Экспрессия CrPII в условиях недостатка азота. Поскольку было
выявлено
повышение
уровня
транскрипции
CrGLB1
в
прегаметах,
инкубированных в течение 4 часов в темноте (данные не приведены), далее нами
была проанализирована роль азота в регуляции накопления мРНК CrGLB1.
Транскрипция CrGLB индуцируется уже после 30 минут удаления аммония из
среды и достигает максимальных уровней в течение 2-4 часов инкубации в среде
без азота в темноте (рисунок 14А).
Ранее было показано, что синхронно растущие вегетативные клетки
дифференцируются в прегаметы в среде без азота в темноте только за 4 часа
(Ermilova et al., 2004). Т.о., увеличение уровня мРНК CrGLB1 в прегаметах по
сравнению с вегетативными клетками является реакцией именно на удаление
азота. Эти данные дополнительно подтверждают заключение о независимости
регуляции CrGLB1от гаметогенеза. Что касается уровней белка PII, то в данном
59
эксперименте также не было выявлено значительных различий при перенесении
клеток в среду без азота (рисунок 14Б).
Относительная экспрессия
A
10
8
6
4
2
0
0
Б
0.5
2
4
TAP
TAP-N, ч
TAP
TAP-N, ч
0
0.5
2
4
CrPII
Рисунок 14. Экспрессия CrPII в вегетативных клетках в условиях недостатка азота.
Выращенные в темноте вегетативные клетки штамма СС-124 переносились из полной среды
(TAP) в среду без азота (TAP-N).
А Уровни относительной экспрессии CrGLB1.
Б Оценка уровней белка CrPII методом Вестерн-блоттинга с использованием PII-специфичных
антител.
3.1.4. Олигомерная структура CrPII
Сигнальные
представляют
белки
собой
PII
у
всех
(гомо)тримерные
проанализированных
белки.
организмов
Сравнительный
анализ
аминокислотных последовательностей демонстрирует, что все необходимые для
образования тримерной структуры консервативные основания, характерные для
PII-белков бактерий и растений, также присутствуют в белке C. reinhardtii
(рисунок 10). Чтобы экспериментально подтвердить формирование тримерных
структур белка CrPII, соответствующий рекомбинантный белок (StrepCrPII-tp),
очищенный до уровня электрофоретической гомогенности. По данным гельфильтрации размер белка составляет около 49 кДа (рисунок 15). Поскольку в
денатурирующем SDS-ПААГ белок мигрирует с молекулярной массой порядка 17
кДа, был сделан вывод о тримерной структуре белка CrPII.
60
Рисунок 15. Анализ олигомерной структуры белка СrPII методом эксклюзионной
хроматографии (гель-фильтрации). mAU – уровень сигнала УФ-детектора при длине волны 280
нм; Ve/Vo – объем элюции.
А Стандартная калибровочная кривая по белкам с известными молекулярными массами.
Б Профиль элюции CrPII.
3.2. Идентификация и характеристика белка PII Chlorella variabilis (CvPII)
3.2.1. Биоинформационный анализ первичной последовательности CvPII
С целью более полной характеристики свойств сигнальных белков PII у
одноклеточных зеленых водорослей в качестве второго модельного объекта была
выбрана Chlorella variabilis NC64A, представляющая собой внутриклеточный
фотобионт Paramecium bursaria. Выбор данного объекта был сделан исходя из
доступности литературных данных по физиологии и методологии данного
модельного объекта. Кроме того, интересно было проанализировать роль белка
PII у зеленой водоросли с принципиально иной экологической средой обитания и,
как
следствие,
отличным
типом
метаболизма
азота
по
сравнению
с
вышеописанной C. reinhardtii.
В недавно просеквенированном геноме C. variabilis NC64Aбыла выявлена
последовательность, кодирующая белок с высокой степенью идентичности с
представителями семейства PII-белков. Был проведен сравнительный анализ
аминокислотных
последовательностей
PII
C.
variabilis
(EFN50797)
с
соответствующими последовательностями охарактеризованных PII-белков C.
reinhardtii, высших растений и бактерий с помощью программного обеспечения
ClustalW (рисунок 16).
61
Рисунок 16. Сравнительный анализ аминокислотных последовательностей PII-белков C.
variabilis, C. reinhardtii, растений и бактерий. Chlamydomonas reinhardtii (Cr; XP_001703658.1),
Arabidopsis thaliana (At; NP_192099.1), Oryza sativa Japonica (Os; NP_001054562.1), Solanum
lycopersicum (Sl; AAR14689.1), Synechococcus PCC 7942 (Sy; P0A3F4.1), Synechocystis sp. PCC
6803 (Sc; CAA66127.1), E. сoli (Ec; AP_003139.1). Выделенные черным остатки консервативны
у 60% анализируемых PII-белков. Блоки I и II обозначают две консервативные
последовательности субсемейства GlnB, PS00496 и PS00638. Белыми и черными стрелками
обозначены позиции тирозиновых оснований, подвергающихся уридилированию в белке PII E.
coli, и сериновых оснований, фосфорилируемых у Synechoccocus PCC 7942, соответственно.
Основания, участвующие в связывании АТФ отмечены черными кружками, NAGK – черными
квадратами, 2-ОГ – черными треугольниками. Выравнивание последовательностей проводилось
с помощью программного обеспечения ClustalW.
Выявленная в базе данных последовательность CvPII укорочена с N-конца
по сравнению с бактериальным белком (рисунок 16). В регионе между
аминокислотами 103 и 189 CvPII, соответствующем бактериальным белкам,
общий процент идентичности белка CvPII и PII E. coli составляет 48,5%. Кроме
того, в пределах этой области аминокислотная последовательность CvPII имеет
высокую степень идентичности с последовательностями PII у репрезентативных
представителей растений и цианобактерий, в том числе: С. reinhardtii (65,7%), А.
thaliana (54,7%), O. sativa Japonica (53,7%), Solanum lycopersicum (53,7%),
Synechococcus PCC 7942 (53,9%) и Synechocystis sp. PCC 6803 (53,4%). Помимо
высокой общей идентичности между различными PII-белками цианобактерий,
растений и C. variabilis, чрезвычайно высокая локальная идентичность
наблюдается в пределах двух характерных последовательностей, называемых
62
PROSITE (PS00496 и PS00638) (рисунок 16). В первичной последовательности
CvPII, также как и в белках C. reinhardtii и некоторых высших растений,
уридилируемый у протеобактерий Tyr-51, локализованный в области Т-петли,
заменен остатком фенилаланина. Это указывает на то, что кодирующая
последовательность белка PII C. variabilis не содержат уридилируемого Tyr.
Кроме того, в белке CvPII консервативный для цианобактерий фосфорилируемый
остаток Ser-49, аналогично белку PII C. reinhardtii, заменен на остаток треонина в
этом сайте (рисунок 16). Это позволяет предположить, что белок CvPII также не
может модифицироваться путем фосфорилирования.
Последовательность В-петли [SТ] -x (3) -G- [DY] -G- [KR] - [IV] - [FW] [LIVM], которая была обнаружена во всех прокариотических PII-белках, а также
белках PII C. reinhardtii и высших растений, также сохраняется у C. variabilis
NC64A. Этот мотив участвует в связывании АТФ между двумя соседними
субъединицами тримерного белка PII. Кроме того, остатки, необходимые для
формирования
бактериальных
и
растительных
тримерных
структур
PII,
сохраняются также у PII C. variabilis (рисунок 16). Эти данные могут указывать на
то, что CvPII образует гомотримеры, как и другие белки этого семейства. Кроме
того, остатки, участвующие в связывании
эффекторных молекул, также
сохраняются в пределах последовательности CvPII.
Примечательно, что белок CvPII C. variabilis, так же как и PII-гомологи C.
reinhardtii
и
высших
растений,
имеет
уникальную
С-концевую
последовательность, которая отсутствует у прокариотических PII-белков. Однако
в отличие от белков семейства, охарактеризованных у высших растений и C.
reinhardtii, в приведенной последовательности CvPII отсутствует уникальная Nконцевая
последовательность,
которая
содержит
сигнальный
пептид,
определяющий хлоропластную локализацию PII-белков фототрофных эукариот. У
красных водорослей гены, кодирующие PII, локализованы в хлоропластном
геноме и их белки не имеют N-концевых сигнальных пептидов (Uhrig et al., 2009).
Однако поскольку ген, кодирующий у C. variabilis анализируемый белок,
находится в ядерном геноме, было выдвинуто предположение, что в приведенной
63
последовательности CvPII не хватает уникального N-концевого участка,
содержащего сигнальный пептид. Для подтверждения данного предположения
необходимо было определить молекулярную массу белка CvPII в клетках C.
variabilis.
3.2.2. Иммунологическая идентификация CvPII
Учитывая высокую идентичность первичных последовательностей PIIбелков C. reinhardtii и C. variabilis, полученные ранее антитела, специфичные к
CrPII (Ermilova et al., 2013), были использованы нами для идентификации PII C.
variabilis методом Вестерн-блоттинга (рисунок 17).
Рисунок 17. Иммунологическая идентификация CvPII методом Вестерн-блоттинга с
использованием CrPII-специфичных антител. 1 - стандартный маркер молекулярных размеров
(кДа); 2 - 10 мкг растворимых белков клеточного экстракта C. reinhardtii; 3 - 20 мкг
растворимых белков клеточного экстракта C. variabilis.
Как видно из полученных результатов, антитела специфично реагировали с
белком C. variabilis. Примечательным является тот факт, что, как и у C.
reinhardtii,
в реакции были выявлены две формы белка: с молекулярными
массами около 22 кДа и 17 кДа. У C. reinhardtii эти формы соответствуют
непроцессированному
и
процессированному,
зрелому
белку,
который
локализован в хлоропласте. Молекулярная масса, рассчитанная для CvPII на
основе последовательности EFN50797, составляет всего 11358,96 Да. Т.о.,
выявленное несоответствие размеров PII C. variabilis, рассчитанного на основе
имеющейся в базе данных последовательности, и полученного с помощью
64
Вестерн-блоттинга, дополнительно свидетельствует о необходимости коррекции
последовательности данного белка. В связи с этим была проведена работа по
анализу недостающей последовательности гена.
3.2.3. Определение последовательности кодирующей цепи ДНК CvPII
По причине высокой степени сложности генома C. variabilis ряд широко
используемых молекулярных методов (Blanc et al., 2010) не позволил выявить
полностью последовательность, кодирующую белок PII. Для определения
последовательности, смежной с известной частью гена, был оптимизирован метод
ПЦР, который позволяет последовательно и эффективно амплифицировать
продукт с достаточным уровнем качества для непосредственного секвенирования.
Эта техника ПЦР-амплификации основана на случайном распределении сайтов
частощепящих рестриктаз в геноме и специальном дизайне праймеров (GonzálezBallester et al., 2005). Все шаги, циклы, теоретически ожидаемые продукты, а
также используемые праймеры приведены на рисунке 18.
Четыре сайта рестрикции (PvuII, BanI, PstI и TaqI) были использованы для
дизайна соответствующих праймеров. Чтобы уменьшить вероятность нахождения
этих сайтов в геноме, при дизайне праймеров был также добавлен один
дополнительный нуклеотид после сайта рестрикции на 3'-конце. Полученные
после второго раунда амплификации конкретные продукты, которые выявлялись
на геле в виде полос высокой интенсивности, непосредственно секвенировались.
В результате ПЦР на матрице геномной ДНК с использованием пар праймеров
DegTaqI/GLB1R2 и Q0/GLB1R1 был изолирован фрагмент размером 2196 п.н.,
последовательность которого соответствует гену, который был обозначен как
CvGLB1 (GenBank: KJ524571). Амплификация внутреннего фрагмента размером
896 пар нуклеотидов (GLB1F1/GLB1R1) указывает на специфичность ПЦРпродукта.
65
Рисунок 18. Схема метода ПЦР-амплификации, основанного на случайном распределении
сайтов частощепящих рестриктаз.
А Схематически обозначенные позиции праймеров и потенциальных сайтов рестрикции.
Известная часть гена обозначена серым прямоугольником.
Б Схема ожидаемых ПЦР-продуктов после первого и второго раундов амплификации,
реамплификации и проверки специфичности. В дегенеративных праймерах последовательность
Q0 обозначена курсивом, а соответствующая сайту рестрикции последовательность выделена
жирным шрифтом
66
Как показано на рисунке 19, кодирующая область гена CvGLB1 содержит
шесть интронов и семь экзонов. Размер интронов колеблется от 87 до 348 п.о.
Сайты сплайсинга экзон/интрон и интрон/экзон согласуются с консенсусными
мотивами G↓GTGAG и (С/А)CAG↓G (инвариантные основания выделены
жирным шрифтом), характерными для ядерных генов (Blanc et al., 2010). На
следующем этапе, в результате ПЦР-амплификации на матрице кДНК с
использованием
праймеров
GLB1F3/GLB1R3,
GLB1F4/GLB1R4
и
GLB1F5/GLB1R5, сконструированных для разных экзонов, были получены
фрагменты ожидаемых размеров – 71 п.о, 120 п.о и 203 п.о., соответственно
(рисунок 19, таблица
1). Кодирующая последовательность ДНК (CDS)
соответствовала белку из 210 аминокислот с расчетным размером 21,96 кДа. Этот
размер соответствует банду в 22 кДa, выявленному при иммунодетекции (рисунок
17). Анализ полученной последовательности белка CvPII, представленной на
рисунке 19, c использованием программного обеспечения ChloroP 1.1 и TargetP1.1
позволил
выявить
потенциальный
сигнальный
пептид,
определяющий
хлоропластную локализацию и состоящий из 47 аминокислотных оснований
(Emanuelsson et al., 1999; Emanuelsson et al., 2007). Расчетная молекулярная масса
зрелого
CvPII,
состоящего
из
162
аминокислот,
составляет
17.1
кДа.
Действительно, в общем клеточном экстракте растворимых белков, помимо
непроцессированной формы белка, иммунологически
также была выявлена
вторая полоса, соответствующая белку этого размера (рисунок 17). Эти данные
указывают на то, что аналогично C. reinhardtii, белок CvPII вероятнее всего
локализован в хлоропласте.
67
Рисунок 19. Структура кодирующей последовательности гена GLB1 и соответствующая
аминокислотная последовательность CvPII C. variabilis.
А Схема экзон-интронной структуры CvGLB1. Черными прямоугольниками обозначены
экзоны, а линиям соответствуют области интронов. ATG – старт-кодон, TAG – стоп-кодон.
Белыми треугольниками обозначены сайты рестрикции TaqI. Пары ПЦР-праймеров обозначены
черными стрелками. В нижней части представлена фотография фрагментов в агарозном геле
после ПЦР на матрице кДНК C. variabilis. GLB1R3 сконструирован для участка экзон1-экзон2.
Б Полная аминокислотная последовательность CvPII.
3.2.4. Транскрипция гена CvGLB1, кодирующего белок CvPII
Рост NC64A на разных источниках азота. Ранее была
показана PII-
зависимая регуляция транспорта нитрата/нитрита для цианобактерий и A. thaliana
(см. гл. 1) (Forchhammer, 2010; Ferrario-Merry et al., 2005; Ferrario-Merry et al.,
2008). В отличие от многих цианобактерий, водорослей и высших растений,
NC64A не растет на нитрате или нитрите (Kamako et al., 2005). Кроме того, в
отличие от C. reinhardtii, для которой предпочтительным источником азота
выступает аммоний, С. variabilis NC64A демонстрирует значительно более низкие
уровни роста (максимальные концентрации клеток) на среде с аммонием в
качестве единственного источника азота, чем в среде MBBM, содержащей
бактопептон в качестве источника азота (рисунок 20). Стоит отметить, что в
стационарной фазе рост сопровождается снижением содержания хлорофилла
68
(рисунок 20). Эти значения согласуются с данными, опубликованными ранее
(Kamako et al., 2005).
Рисунок 20. Рост C. variabilis NC64A на разных источниках азота.
А Кривые роста. Число клеток (кривые) и содержание хлорофилла (столбцы) анализировалось
на протяжении 10 суток на среде MBBM (черные символы) и среде с 10 мМ аргинина (белые
символы). В инсерции представлены кривые роста на среде с 25 мM NH4+ (серые символы).
Б Время удвоения C. variabilis на разных источниках азота.
Кроме того, L-аргинин также может использоваться клетками С. variabilis
NC64A в качестве единственного источника азота (McAuley, 1986). Согласно
полученным данным этот штамм демонстрирует наиболее высокую скорость
роста и достигает максимальной концентрации клеток при 10 мМ аргинина в
среде (рисунок 20Б). При росте на данном источнике азота NC64A достигает
стационарной фазы при концентрации ~ 2 × 107 клеток на мл (рисунок 20A).
Причем не было выявлено достоверных отличий в параметрах роста при
выращивании на среде с более высокой концентрацией аргинина (15мМ) по
сравнению со средой, содержащей 10 мМ аргинина (рисунок 20Б). Нами был
проведен дополнительный анализ содержания хлорофилла в клетках. Несмотря на
то, что самое низкое содержание хлорофилла было зафиксировано в клетках,
выращенных на MBBM, они имели наименьший средний диаметр клеток (4 μм и
4.2 μм в середине экспоненциальной и стационарной фаз роста). Промежуточные
размеры диаметров соответствовали клеткам, выращенным на среде с аргинином
(4.9 μм и 5.2 μм, соответственно). Поскольку была выявлена зависимая от азота
69
регуляция экспрессии PII белка у C. reinhardtii, возник вопрос о возможной
регуляции PII-белка C. variabilis. Однако в связи с тем, что не было найдено
литературных данных по экспрессии генов у C. variabilis, необходимо было
провести предварительную работу по поиску подходящего референс-гена для
количественного анализа экспрессии.
Выбор
референс-гена
для
анализа
экспрессии
генов
методом
количественного ПЦР в режиме реального времени. Для достоверного анализа
экспрессии необходима нормализация экспрессии генов относительно гена,
транскрипция которого не изменяется в условиях проводимого эксперимента
(референс-ген). Поиск по базам данных С. variabilis NC64A позволил выявить
несколько потенциальных кандидатов на роль референс-генов, кодирующих
предполагаемые белки GPD1 (глицеральдегид-3-фосфатдегидрогеназа), EF1A
(фактор элонгации 1α), АСТ (актин), MDH3 (малатдегидрогеназа), PYK
(пируваткиназа), UBI (убиквитинлигаза Е2) и CBLP (рецептор активируемой
протеинкиназы С1). Для начала был проведен анализ экспрессии выбранных
предполагаемых генов домашнего хозяйства в условиях присутствия и отсутствия
разных источников азота на этапах жизненного цикла C. variabilis. Полученное
распределение уровней Ct приведено на рисунке 21.
70
Рисунок 21. Распределение уровней Ct кандидатов на референс-гены в экспоненциальной
(ранней, средней, поздней) и стационарной фазах роста клеток C. variabilis, выращенных на
МВВМ (черный) и средах с 10 мМ аргинина (белый), с 25 мMNH4+ (светло-серый) или в среде
без азота (темно-серый). рэ – кДНК из клеток в ранней экспоненциальной фазе; сэ – кДНК из
клеток в средней экспоненциальной фазе; пэ – кДНК из клеток в поздней экспоненциальной
фазе; с – кДНК из клеток в стационарной фазе; -N– кДНК из клеток на среде без источника
азота.
71
В качестве контрольного гена необходимо было выбрать кандидата с
наиболее стабильной экспрессией, т.е. с наименьшим коэффициентом вариации
(CV) и разбросом значений
не более чем в 2 раза (MFC, отношение
максимального и минимального значения, наблюдаемого в наборе данных) (De
Jonge et al., 2007). Все 7 проанализированных генов имели суммарный CV более
4% (таблица 2). Таким образом, GPD1, EF1A, АСТ, MDH3, PYK, UBI и CBLP в
данном случае не могут быть использованы к качестве референс-генов из-за
слишком высокой степени вариабельности транскрипции при росте на разных
источниках азота.
Таблица 2.
Ген
Среда с аргинином
MBBM
Среда с аммонием
Среда без азота
Ср
SD
CV
MFC
Ср
SD
CV
MFC
Ср
SD
CV
MFC
Ср
SD
CV
MFC
UBI
25.88
0.683
2.65
1.11
27.20
1.319
4.85
1.14
28.29
0.534
1.89
1.06
27.7
0.739
2.67
1.06
CBLP
22.75
1.323
5.82
1.16
23.97
1.259
5.25
1.06
24.94
0.552
2.21
1.08
24.51
1.131
4.62
1.11
EF1A
17.45
1.902
10.9
1.34
20.03
0.508
2.53
1.09
20.68
0.874
4.23
1.13
18.48
1.169
6.33
1.15
GPD1
26.21
2.149
8.20
1.28
30.34
0.994
3.28
1.10
29.78
1.189
3.99
1.12
28.57
1.667
5.83
1.15
PYK
24.58
1.758
7.15
1.24
27.93
0.812
2.91
1.08
27.93
1.204
4.31
1.12
25.65
1.097
4.28
1.12
MDH3
21.54
1.876
8.71
1.25
24.35
1.318
5.41
1.16
24.65
1.123
4.56
1.12
23.95
0.420
1.76
1.04
AKT
26.20
1.029
3.93
1.11
29.56
1.035
3.50
1.11
29.01
0.941
3.24
1.09
28.47
0.808
2.84
1.07
GLB1
30.58
0.962
3.14
1.09
30.62
0.597
1.95
1.05
31.02
0.658
2.12
1.04
31.22
0.344
1.1
1.02
Ср – среднее Ct; CV – коэффициент вариации, равный стандартному отклонению, деленному на среднее
(выражен в процентах); MFC – отношение максимального и минимального Ct по разным опытам.
Анализ экспрессии CvPII в средах с разными источниками азота.
Экспрессия гена CvGLB1 была проанализирована в клетках из экспоненциальной
(ранней, средней и поздней) и стационарной фаз роста культур, выращенных на
среде MBBM, а также на средах с аргинином и аммонием в качестве источников
азота. Средние значения Ct в этих условиях представлены на рисунке 22А.
Примечательно, что этот ген (CvGLB1) имел CV ниже
использованных
условиях
(таблица
2).
Чтобы
уровня 4% при всех
показать,
что
CvGLB1
72
экспрессируется на постоянном уровне на средах с разными источниками азота и
в среде без азота, была проведена нормализация относительно генов с
постоянным уровнем экспрессии в условиях эксперимента (рисунок 22Б и 22В).
Рисунок 22. Анализ экспрессии гена CvGLB1 методом ПЦР в режиме реального времени в
условиях роста на разных источниках азота. рэ – кДНК из клеток в ранней экспоненциальной
фазе; сэ – кДНК из клеток в средней экспоненциальной фазе; пэ – кДНК из клеток в поздней
экспоненциальной фазе; с – кДНК из клеток в стационарной фазе; -N – кДНК из клеток на среде
без источника азота.
А Вариация уровней Ct гена CvGLB1 в пробах в экспоненциальной (ранней, средней, поздней)
и стационарной фазах роста на среде МВВМ (черный) и средах с 10 мМ аргинина (белый), 25
мM NH4+(светло-серый) или после инкубации на среде без азота (темно-серый).
Б Относительные уровни транскрипции CvGBL1 на разных стадиях роста на среде с 10 мМ
аргинина и МВВМ. UBI использовался в качестве референс-гена для клеток, выращенных на
МВВМ, ACT – для клеток, выращенных на среде с аргином в качестве источника азота. Уровни
белка CrPII приведены на верхней панели. Антитела против HSP70В использованы для
контроля загрузки.
В Относительные уровни транскрипции CvGLB1 на среде без азота. Клетки C. variabilis
выращивали на среде с источником азота до логарифмической фазы и переносили на среду без
азота на 2 и 24 ч. Относительные уровни экспрессии нормализованы относительно экспрессии
гена MDH3. Увеличение транскрипции AMT1 использовалось в качестве позитивного контроля
ответа клеток на голодание по азоту.
73
UBI
использовался
в
качестве
внутреннего
контроля
для
клеток,
выращенных на MBBM, а ACT был использован для клеток, выращенных на
аргинине в качестве источника азота (рисунок 22В). Было показано, что в среде с
аргинином относительные уровни экспрессии CvGLB1 были близки во всех типах
клеток, свидетельствуя о том, что транскрипция CvGLB1 не зависит от фазы роста
(рисунок 22Б). Варьирования в уровнях белка CvPII также не было выявлено
(рисунок 22Б, верхняя панель).
Примечательно, что перенос из среды с
аргинином в среду MBBM также не приводил к изменению транскрипции
CvGLB1 или уровней белка CvPII (рисунок 22Б). Полученные нами результаты
указывают на то, что экспрессия CvGLB1 не зависит от стадии роста или
источника азота.
Поскольку голодание индуцирует транскрипцию GLB1 у С. reihardtii
(рисунок
14),
было
проверено,
не
контролируется
ли
и
экспрессия
CvGLB1удалением азота из среды. Для этого клетки C. variabilis были выращены
на среде MBBM до середины экспоненциальной фаза роста, а затем переведены в
среду без азота (рисунок 22В). Ген AMT1 (GenBank: 17352992), имеющий
сходство с транспортером аммония AMT1;2 А. thaliana, индуцируется удалением
азота из среды, также как это сообщалось ранее для AMT1-генов C. reinhardtii
(Ermilova
et
al.,
2013).
Увеличение
уровня
транскрипции
AMT1 было
использовано в качестве положительного контроля. Полученные результаты
указывают на то, что экспрессия гена CvGLB1 не зависит от доступности
источника азота.
3.2.5. Олигомерная структура CvPII
Сравнительный анализ аминокислотной последовательности белка CvPII с
другими представителями этого семейства показал, что остатки, необходимые для
формирования тримерных структур бактериальных и растительных белков PII,
сохраняются и в белке C. variabilis (рисунок 16). Для экспериментального
подтверждения образования гомотримеров рекомбинантный белок CvPII был
синтезирован в клетках E.coli RB9060. Очищенный до электрофоретической
74
гомогенности зрелый рекомбинантный белок StrepCvPII-tp элюировал на
эксклюзионной хроматографической колонке в виде единственного пика,
соответствующего молекулярной массе 53,5 кДа (рисунок 23). Поскольку
расчетная молекулярная масса мономера StrepCvPII-tp составляет 18440,03 Да, то
было сделано заключение о тримерной структуре белка CvPII.
Рисунок 23. Анализ олигомерной структуры белка CvPII методом эксклюзионной
хроматографии (гель-фильтрации). mAU – уровень сигнала УФ-детектора при длине волны 280
нм; Ve/Vo – объем элюции.
А Стандартная калибровочная кривая по белкам с известными молекулярными массами.
Б Профиль элюции CvPII.
3.3. Характеристика N-ацетил-L-глутаматкиназ (NAGK)
C. reinhardtii и C. variabilis
3.3.1. Биоинформационный анализ первичных последовательностей
CvNAGK и CrNAGK
В последовательностях CrPII и CvPII были выявлены консервативные
остатки,
которые
у
цианобактерий
и
высших
растений
отвечают
за
взаимодействие PII с N-ацетил-L-глутаматкиназой (NAGK). Как уже упоминалось,
NAGK является ключевым ферментом биосинтеза аргинина (см. гл. 1), активность
которого у цианобактерий и высших растений контролируется PII. Ранее
сообщалось, что ключевыми основаниями в последовательности NAGK S.
elongatus для взаимодействия с PII являются Glu194, Arg233, Arg254, Ala257 и
Gln258,
которые
консервативны
и
уникальны
среди
оксигенных
75
фотосинтезирующих
организмов,
включая
C.
reinhardtii
и
С.
variabilis
(Chellamuthu et al., 2013). Более того, утеря этих оснований в последовательностях
NAGK двух красных водорослей (Gracilaria tenuistipitata и Cyanidioschyzon
merolae) коррелирует с отсутствием PII белков у этих организмов (Llacer et al.,
2007; Chellamuthu et al., 2013). Кроме того, отмечалась высокая степень
консервативности и уникальность цистеиновой пары Cys-Сys на С-конце NAGK
оксигенных фотосинтезирующих организмов, в том числе одноклеточных
зеленых водорослей, расположенной между основаниями Arg233 и Ala257
последовательности SeNAGK. Несмотря на то, что эта цистеиновая пара не
принимает непосредственного участия в формировании комплекса PII-NAGK,
было предположено наличие пока не идентифицированного редокс-зависимого
механизма контроля синтеза аргинина при смене условий свет/темнотау
цианобактерий и растений (Chelamuthu et al., 2013).
В геномах C. reinhardtii и C. variabilis были выявлены гены белков
CrNAGK1
(EDP09199.1)
и
CvNAGK
(EFN52177.1),
кодирующие
соответствующие ферменты. Белок CrNAGK состоит из 340 аминокислотных
остатков с молекулярной массой 35,97 кДа, а белок CvNAGK состоит из 343
аминокислот и с молекулярной массой 36,23 кДа. У эукариотических
фотосинтезирующих организмов гены, кодирующие эти белки, находятся в ядре,
а продукты имеют хлоропластную локализацию. С помощью программного
обеспечения ChloroP и TargetP удалось идентифицировать сигнальные пептиды в
белках CrNAGK и CvNAGK, которые предполагают их локализацию в
хлоропластах.
Длина
транзитнотного
пептида
CrNAGK
составляет
42
аминокислоты, а молекулярная масса зрелого белка 31,47 кДа. В свою очередь
длина
транзитнного
пептида
CvNAGK
составляет
47
аминокислот,
а
молекулярная масса зрелого белка 33,4 кДа.
Сравнительный анализ аминокислотных последовательностей показал, что
NAGK C. reinhardtii и C. variabilis демонстрируют достаточно высокий процент
идентичности с последовательностями NAGK A. thaliana (55,25% для C.
76
reinhardtii и 52,37% для C. variabilis) и S. elongates (57,47% и 61.67%,
соответственно) (рисунок 24).
Также в обоих белках зеленых водорослей были выявлены консервативные
домены белков NAGK, которые у E. coli участвуют в связывании NAG и ATP.
Рисунок 24. Сравнительный анализ аминокислотных последовательностей NAGK C.
reinhardtii, C. variabilis с соответствующими последовательностями бактерий и высших
растений. Chlamydomonas reinhardtii (Cr; EDP09199.1), Chlorella variabilis (Cv; EFN52177.1),
Arabidopsis thaliana (At; AEE79672.1), Oryza sativa Japonica (Os; BAD25688.1), Solanum
lycopersicum (Sl; NP_001306260.1), Synechococcus elongatus PCC 6301 (Se; BAD80672.1),
Synechocystis sp. PCC 6803 (Sy; ALJ67082.1), E. сoli (Ec; EDV66610.1). Выделенные черным
остатки консервативны у 60% анализируемых NAGK-белков. Основания, участвующие в
образовании
комплекса
с
PII
отмечены
черными
кружками.
Выравнивание
последовательностей проводилось с помощью программного обеспечения ClustalW.
77
3.3.2. Олигомерная структура CvNAGK и CrNAGK
Белки NAGK у всех ранее изученных организмов представляют собой
гексамеры. Поскольку при анализе аминокислотных последовательностей
CrNAGK и CvNAGK была выявлена высокая степень идентичности, есть
основания предполагать значительную степень сходства структуры и функции
этих белков.
Для
экспериментального
доказательства
гексамерной
структуры
рекомбинантный белок CvNAGK с N-концевым полигистидиновым тагом был
синтезирован в E. coli штамм Rosetta (Novagen). Расчетная молекулярная масса
этого рекомбинантного белка составляет 33396,51 Да. Анализ очищенного до
электрофоретической гомогенности рекомбинантного белка CvNAGK методом
гель-фильтрации показал, что CvNAGK элюирует в виде единственного пика,
соответствующего гексамерной форме фермента (рисунок 25). Для сравнения,
олигомерное состояние C. reinhardtii NAGK (CrNAGK) было гетерогенным по
размеру (рисунок 25, инсерция; Chellamuthu et al., 2014), указывая на то, что
гексамерное состояние NAGK C. variabilis является более стабильным, чем у C.
reinhardtii.
Рисунок 25. Анализ олигомерной структуры белка CvNAGK методом эксклюзионной
хроматографии (гель-фильтрации).
А Стандартная калибровочная кривая по белкам с известными молекулярными массами.
Б Профиль элюции CvNAGK. Инсерция – профиль элюции CrNAGK.
78
3.4. Взаимодействие PII-белков с N-ацетил-L-глутаматкиназами
3.4.1. Формирование комплексов PII-NAGK
Как было отмечено выше, в последовательностях CrPII и CvPII выявлены
консервативные остатки, которые у цианобактерий и высших растений отвечают
за взаимодействие PII с N-ацетил-L-глутаматкиназой (NAGK) (рисунок 16),
которая является ключевым ферментом биосинтеза аргинина. Активность NAGK
у цианобактерий и высших растений контролируется PII. Ранее были получены
кристаллические структуры PII-NAGK S. elongatus (Llacer et al., 2007) и A.
thaliana (Mizuno et al., 2007б), согласно которым три димера NAGK образуют
гексамерный тороид с двумя идентичными поверхностями, взаимодействующими
с двумя тримерами PII (рисунок 4). В работе коллег было показано, что
сигнальный белок PII C. reinhardtii активирует NAGK по глутамин-зависимому
принципу (Chellamuthu et al., 2014). Методом эксклюзионной хроматографии был
проанализирован процесс формирования комплексов между CvPII и CvNAGK
(рисунок 26). В отсутствии эффекторных молекул, несмотря на образование
комплекса CvPII-CvNAGK, также присутствуют высокомолекулярные агрегаты,
что может указывать на нарушение конформации белков при образовании
комплекса.
Кроме того,
даже
в
присутствии
Mg-АТФ
не
происходит
эффективного образования комплексов с четким пиком элюции. Однако при
добавлении к смеси 15 мМ глутамина элюируемая фракция, соответствующая по
размеру комплексу из двух тримеров CvPII и одного гексамера CvNAGK,
значительно
увеличилась,
что
сопровождалось
снижением
количества
высокомолекулярных олигомеров.
Полученные результаты хорошо согласуются с литературными данными,
согласно которым одна молекула NAGK взаимодействует с двумя молекулами
PII. Интересно, что в присутствии 2-ОГ профиль элюции не изменялся и
идентифицировался единственный пик с молекулярной массой близкой к 265 кДа
(рисунок 26). Таким образом, 2-ОГ не оказывает ингибирующего действия на
79
образование комплекса NAGK-PII. Сходное действие 2-ОГ было описано и для
комплекса CrPII-CrNAGK (Chellamuthu et al., 2014).
Рисунок 26. Анализ формирования комплекса CvPII-CvNAGK методом гель-фильтрации.
Молекулы-эффекторы добавлялись в смесь белков до реакции кросс-линкинга. Глутаминзависимое взаимодействие CvPII с CvNAGK показано при 15 мМ глутамина и 2 мМ Mg-АТФ
(черная сплошная линия). Влияние 2-ОГ на формирование комплекса показано при
концентрации 0.5 мМ 2-ОГ (серая пунктирная линия).
3.4.2. Действие PII на активность NAGK
3.4.2.1. Глутамин-зависимая регуляция белками PII активности NAGK
одноклеточных зеленых водорослей
Характеристика ферментативной активности CvNAGK. Характеристика
каталитической активности фермента NAGK определялась с использованием
описанного ранее метода сопряженных ферментных реакций (Beez et al., 2009).
Были определены
кинетические константы очищенного рекомбинантного
фермента CvNAGK, который демонстрировал значения Km для NAG 1,5 ± 0,12
мM и максимальное значение Kcat 35,35 ± 1,04 с-1 (рисунок 27). Значение Km
близко полученному ранее Km Arabidopsis thaliana AtNAGK (Km (NAG) 0,87 ±
0,11 мм), но в 5 раз ниже, чем у цианобактерий Synechococcus elongatus SeNAGK
(Km (NAG)
в
7,4
мМ).
Примечательно,
что
значение
Kcat
является
80
промежуточным между значениями, зафиксированными для AtNAGK (126 с-1) и
SeNAGK (13 с-1) (Beez et al., 2009). Значения обоих кинетических параметров для
CrNAGK несколько выше, чем у Chlorella (Km (NAG) 7,7 мМ и Kcat 56,76 с-1), что
указывает на более высокую скорость протекания реакции, но меньшую
чувствительность к субстрату у белка Chlamydomonas (Chellamuthu et al., 2014).
Следует отметить, что добавление PII в реакционную смесь лишь незначительно
отражалось на кинетических параметрах CvNAGK.
Рисунок 27. Активность CvNAGK в зависимости от концентрации субстрата NAG в
присутствии и отсутствии PII.
Ингибирование аргинином активности NAGK представляет собой ключевой
регуляторный механизм, контролирующий биосинтез аргинина. В связи с этим,
были проведены исследования эффекта ингибирования CvNAGK аргинином.
Значение половины максимальной ингибирующей концентрации аргинина (IC50)
составило 1,2 ± 0,05 мМ (рисунок 28), что близко к значению, определенному для
AtNAGK (1 мМ). Однако было показано, что значительно более высокие
концентрации аргинина были необходимы для ингибирования CvNAGK по
сравнению с CrNAGK (IC50 0.11 мМ).
81
Рисунок 28. Ингибирование аргинином активности CvNAGK.
А Ингибирующее действие аргинина на активность CvNAGK в отсутствии и присутствии CvPII
с 15 мМ глутамина.
Б Ингибирующее действие аргинина на активность CvNAGK (в процентах).
Ранее было показано, что белок PII способен ослаблять ингибирующее
действие аргинина на NAGK (Beez et al., 2009). Однако в ходе исследования было
обнаружено, что белки одноклеточных зеленых водорослей CrPII и CvPII
способны выполнять данную функцию только в присутствии глутамина. Для
детальной количественной характеристики этого эффекта, глутамин титровался в
реакции ингибирования аргинином CvNAGK-CvPII в соотношениии PII (тример)
к NAGK (гексамер) равном
5:1. Как показано на рисунке 28 глутамин в
комбинации с CvPII действительно может активировать ингибированный
аргинином CvNAGK, и в присутствии 15 мМ глутамина ингибирующий эффект
аргинина значительно снижен. Добавление CvPII и 15 мМ глутамина к CvNAGK
повышало IC50 аргинина для CvNAGK с 1,2 ± 0,05 мМ до 4,18 ± 0,35 мМ.
Поскольку наибольшая разница в активности CvNAGK в присутствии или в
отсутствии CvPII с глутамином наблюдалась при 2 мМ аргинина, то именно эта
концентрация аргинина использовалась для титрования эффекта глутамина
(рисунок 29). Было показано, что глутамин активировал ингибированный
аргинином CvNAGK в присутствии CvPII по концентрационно-зависимому
механизму.
Половина
максимальной
эффективной
концентрации
(ЕС50)
82
глутамина для активации NAGK с помощью CvPII была определена как 6,5 ± 1,1
мМ. Этот ответ сходен с зависимой от глутамина активацией CrNAGK белком
CrPII, где значение EC50 для глутамина составило 4.6 ± 2,4 мМ (Chellamuthu et
al., 2014).
Рисунок 29. Эффект глутамина на способность CvPII активировать CvNAGK. Энзиматические
реакции проводились в присутствии 2 мМ аргинина.
Каталитические константы комплекса CvPII-CvNAGK, определенные в
присутствии 15 мМ глутамина, указывают на то, что CvPII способен повышать
максимальную скорость (Kcat 44,3 ± 1,05 c-1 сравнению с 25,6 ± 4,78 c-1) реакции
ингибированного арнинином NAGK и снижать Km для NAG приблизительно в
20,5 раз (4,5 ± 0,52 мМ по сравнению с 92,4 ± 23,7 мМ) (рисунок 30). Этот эффект
аналогичен тому, что показано для белков С. reinhardtii, где PII имеет только
незначительный эффект на каталитические константы NAGK в отсутствии
аргинина,
тогда
как
основная
функция
PII
проявляется
в
модуляции
ингибирования NAGK аргинином по обратной связи (Chellamuthu et al., 2014).
83
Рисунок 30. Активность ингибированного аргинином CvNAGK в зависимости от концентрации
субстрата NAG в присутствии и отсутствии PII.
Одной из молекул-эффекторов, с которой связываются бактериальные и
растительные белки семейства PII, является 2-ОГ. У цианобактерий связывание 2ОГ препятствует взаимодействию PII с его мишенями, а у A.thaliana препятствует
PII-зависимому снятию ингибирования аргинином без диссоциации комплекса. В
последовательности CvPII также выявлены основания, необходимые для
связывания 2-ОГ (рисунок 16). Чтобы определить характер действия 2-ОГ на
взаимодействие CvPII-CvNAGK, был проведен эксперимент, в котором PII и
NAGK (в соотношении 5 PII триммеров к 1 NAGK гексамеру) инкубировали
вместе в присутствии глутамина (15 мM) и аргинина (2 мM), а затем титровали с
возрастающими концентрациями 2-ОГ. Как было описано выше, аргинин в
концентрации 2мМ практически не ингибировал комплекс CvNAGK-CvPII, но
оказывал значительное ингибирующее действие на свободный NAGK (рисунок
30). Из рисунка 31 видно, что 2-ОГ способен снижать активность NAGK по
зависимому от концентрации принципу. Половина максимальной ингибирующей
концентрации для деактивации NAGK (IC50) достигается при 0,23 ± 0,019 мM 2ОГ. Эта концентрация отражает сродство CvPII к эффекторной молекуле 2-ОГ,
которая, предположительно, отражает адаптацию сенсорного белка PII к
84
физиологически значимым концентрациям этой эффекторной молекулы. Это
значение является промежуточным между значениями, определенными для
A.thaliana AtNAGK (IC50 0,036 мM) и С. reinhardtii CrNAGK (IC50 1,2 мM) (Beez
et al., 2009; Chellamuthu et al., 2014).
Рисунок 31. Эффект 2-оксоглутарата на активность CvNAGK.
Рост штамма Chlorella NC64A на глутамине в качестве источника азота.
Поскольку был выявлен опосредованный глутамином эффект CrPII на активность
NAGK in vitro, необходимо было проанализировать, оказывает ли влияние
метаболизируемый глутамин на клеточные уровни аргинина в естественных
условиях. Для этого штамм C. variabilis NC64A был выращен на среде с
глутамином в качестве источника азота с определением параметров роста в
данных условиях. Глутамин может служить источником углерода и азота для
большого разнообразия микроорганизмов (Forchhammer, 2007). Некоторые
штаммы Chlorella также могут использовать глутамин в качестве ключевого
источника азота (Kato и Imamura, 2009). Исключением стал симбиотический
штамм NC64A, который не показал поглощения этой аминокислоты (McAuley,
1986). Мы предположили, что клетки NC64A могут использовать низкоаффинный
транспортер для поглощения глутамина, который не способен поддерживать рост
на 2 мМ глутамина в среде. Согласно тому, как это было описано ранее, клетки в
таких условиях были бледными и неправильной формы (McAuley, 1986). Тем не
менее, в присутствии 10 мМ глутамина, клетки NC64A не только восстанавливали
85
рост, но и демонстрировали более высокую скорость роста и клеточные
концентрации, что указывает на то, что клетки способны быстро утилизировать
этот источник азота (рисунок 32). Следует отметить, что не было выявлено
дальнейшего увеличения скорости роста после 15 мМ глутамина (рисунок 32Б).
Это также было подтверждено в экспериментах по оценке содержания
хлорофилла.
Рисунок 32. Рост C. variabilis NC64A на глутамине.
А Кривые роста. Число клеток (кривые) и содержание хлорофилла (столбцы) анализировалось
на протяжении 10 суток на среде MBBM (черные символы), а также в среде с 10 мМ глутамина
(белые символы) и с 2 мМ глутамина (серые символы). В инсерции представлены кривые роста
на среде с 25 мMNH4+.
Б Время удвоения С. variabilis при росте средах с 2, 10 и 15 мМ глутамина.
Далее необходимо было проверить, не дезаминируется ли глутамин
внеклеточно, а затем поступает в клетки в виде аммония, как это происходит у C.
reinhardtii и многих других организмов (Muñoz-Blanco et al., 1990). В связи с тем,
что клетки NC64A не способны поглощать глутамат (Kato и Imamura, 2009;
McAuley, 1986), нами были проведены эксперименты по оценке внеклеточных
уровней глутамата в среде с 10 мМ глутамина. Было показано, что рост клеток на
10 мМ глутамина не сопровождался детектируемым увеличением внеклеточных
уровней глутамата в среде (данные не приведены). Эти результаты указывают на
то, что именно глутамин, а не аммоний используется клетками С. variabilis
NC64A. Более того, в среде с аммонием NC64A демонстрирует значительно более
низкие параметры роста, чем в среде, содержащей глутамин (рисунок 32, вставка).
86
Таким образом, симбиотическая водоросль С. variabilis штамм NC64A может
использовать глутамин в качестве источника азота при условии его высоких
концентраций.
Внутриклеточное накопление аргинина в клетках штамма NC64A при его
росте на глутамине. После того, как была показана уникальная роль глутамина в
качестве необходимой молекулы-эффектора для работы комплекса PII-NAGK
одноклеточных зеленых водорослей, возник вопрос о возможной роли глутамина
при синтезе аргинина в естественных условиях. Тот факт, что C. variabilis
способна непосредственно транспортировать глутамин из среды в клетку, без
предварительного внеклеточного деаминирования, делает эту одноклеточную
зеленую водоросль прекрасным модельным объектом для изучения этого вопроса.
Чтобы определить, сопровождаются ли изменения во внешних концентрациях
глутамина в среде какими-либо флуктуациями в содержании аргинина, общий
уровень свободного аргинина измеряли клетках NC64A в экспоненциальной (в
начале и в конце) и стационарной фазах роста на среде MBBM, содержащей
бактопептон в качестве источника азота, а также на среде с 10 мМ или 2 мМ
глутамина в качестве единственного источника азота (рисунок 33).
Рисунок 33. Влияние концентраций глутамина в среде на внутриклеточное содержание
аргинина и активность GS у C. variabilis NC64A. рэ – ранняя экспоненциальная фаза роста; пэ –
поздняя экспоненциальная фаза роста; с – стационарная фаза роста.
А Внутриклеточное содержание аргинина в клетках, выращенных на МВВМ, а также среде с 2
и 10 мМ глутамина.
Б Определение активности GS в клетках, выращенных на МВВМ, а также среде с 2 и 10 мМ
глутамина.
87
Концентрация
аргинина
в
клетках,
выращенных
на
MBBM
до
экспоненциальной фазы (~ 0,5 мкг аргинина /мкг хлорофилла) и перенесенных на
среду с 10 мМ глутамина увеличилась в 5 раз в экспоненциальной фазе и в 1,8
раза в стационарной фазе роста. Было предположено, что эти изменения в
уровнях внутреннего аргинина могут быть результатом изменений в поглощении
и ассимиляции глутамина. Чтобы это проверить, содержание аргинина также
измеряли в клетках, выращенных на среде с 2 мМ глутамина, когда NC64A
демонстрирует значительно более низкую скорость роста, чем в среде,
содержащей 10 мМ глутамина. Как и ожидалось, уровни аргинина в клетках С.
variabilis, выращенных на среде с 2 мМ глутамина, примерно в 2 раза ниже, чем в
клетках, выращенных на среде с 10 мМ глутамина. Примечательно, что клетки,
выращенные на среде с 10 мМ глутамина, демонстрируют приблизительно
трехкратное увеличение пула аргинина по сравнению с клетками, выращенными
на MBBM с бактопептоном в качестве источника азота (рисунок 33). Таким
образом, экзогенный глутамин, содержащийся в среде, приводит к повышению
уровней внутриклеточного аргинина.
Действие
глутамина
на
активность
и
экспрессию
GS.
Чтобы
дополнительно подтвердить, что экзогенный глутамин способен оказывать
влияние на биосинтетические реакции в NC64A, общая активность GS также
определялась при разных условиях роста (рисунок 33Б). В среде MBBM
активность фермента в клетках в поздней экспоненциальной и в стационарной
фазах роста была выше, чем в клетках на ранней экспоненциальной фазе (рисунок
33Б). Примечательно, что в среде с 10 мМ глутамина активность GS была
значительно снижена по сравнению со средой MBBM. Более того, значения были
даже ниже, чем в начале экспоненциальной фазы в среде MBBM. Активность GS
также поддерживалась на низком уровне при росте на 2 мМ глутамина. Судя по
всему, активность GS негативно регулируется внешним глутамином, указывая на
то, что внешний глутамин влияет на внутриклеточный метаболизм азота. Эти
данные хорошо согласуются с тем, что было показано для многих бактерий, где
GS отрицательно регулируется в условиях избытка глутамина.
88
Чтобы определить, происходит ли репрессия активности GS на уровне
транскрипции
или
посттранскрипционно,
был
проведен
поиск
последовательностей генов по базам данных C. variabilis NC64A. Два выявленных
кандидата для обеих изоформ GS были обозначены как CvGS1 (EFN58800.1) и
CvGS2 (EFN56917.1). Поскольку экспрессия гена GS1 у С. reinhardtii подавляется
аммонием
(Chen и Silflow, 1996), мы сначала проанализировали действие
аммония на экспрессию генов CvGS (рисунок 34).
После перенесения клеток NC64A, выращенных на MBBM, на среду с 25
мМ аммония уровни транскриптов CvGS1 и CvGS2 оставались практически
неизменными (рисунок 34АБ). Уровень транскрипта CvGS1 увеличивался в 5,7 и
3,2 раза, когда клетки инкубировали с метионин-DL-сульфоксимином (MSX),
специфическим ингибитором глутаминсинтетазы, в течение
4 ч и 24 ч,
соответственно. Тем не менее, не было выявлено заметного влияния MSX на
уровень мРНК CvGS1 после 1 ч инкубации (рисунок 34A). Неизменный уровень
экспрессии CvGS1 после 1 ч инкубации с MSX согласуется с данными,
демонстрирующими полное ингибирование общей активности GS только после 2
ч с момента добавления MSX (данные не приведены). Интересно, что уровни
транскриптов CvGS2 также сильно возрастают в течение 4 ч и 24 ч после
добавления MSX (рисунок 34Б). Наблюдаемое увеличение экспрессии CvGS1и
CvGS2 в среде с аммонием в присутствии MSX предполагает, что глутамин или
его производные участвуют в репрессии обоих генов CvGS.
Кроме того, было выявлено, что уровни обоих транскриптов максимально
возрастают через 4 ч голодания по азоту (рисунок 34В). Уровни транскриптов
CvGS1 и CvGS2 были значительно выше в среде без азота, чем в среде,
содержащей
глутамин,
демонстрируя
негативное
влияние
глутамина
на
экспрессию этих генов. Кроме того, можно сделать вывод, что обе формы
глутаминсинтетазы С. variabilis не находятся под непосредственным контролем
внутриклеточного аммония, так как уровни их транскриптов не возрастали в среде
без аммония.
89
Рисунок 34. Анализ уровней экпрессии генов CvGS методом ПЦР в режиме реального времени
при выращивании на средах с разными источниками азота и среде без азота.
А Относительные уровни транскрипции CvGS1. Клетки Chlorella были выращены на МВВМ и
перенесены на с среду с аммонием в присутствии и отсутствии 2 мМ MSX или на среду с
глутамином на 1 ч, 4 ч и 24 ч. Ген ACT1 был использован в качестве нормализатора.
Б Относительные уровни транскрипции CvGS1. Клетки Chlorella были выращены как описано в
пункте А.
В Относительные уровни транскрипции генов CvGS на среде без источника азота. Клетки
Chlorella были выращены на среде МВВМ и перенесены на среду без азота на 2 ч и 24 ч.
90
3.4.2.2. Глутамин-зависимая регуляция белками PII
активности NAGK растений
До недавнего времени единственным эукариотическим организмом, для
которого детально был изучен эффект PII на активность ингибированного
аргинином NAGK, оставался A. thaliana (представитель семейства Brassicaceae).
В связи с тем, что на одноклеточных зеленых водорослях Chlamydomonas и
Chlorella впервые был обнаружен описанный выше феномен опосредованного
глутамином
PII-сигналинга,
возник
вопрос
об
уникальности
или
консервативности данного явления. Поскольку данные кристаллографии белка C.
reinhardtii указывали на то, что в связывании глутамина участвуют аминокислоты
на С-конце PII (этот участок белка был назван Q-петлей), был проведен
сравнительный анализ последовательностей растительных белков PII (рисунок
35), который показал, что остатки Q-петли являются частью консервативного
мотива
на
С-конце,
и
присутствуют
во
всех
проанализированных
последовательностях, за исключением сем. Brassicaceae, к которому принадлежит
А. thaliana.
91
Рисунок 35. Выравнивание аминокислотных последовательностей С-конца белков PII растений
и цианобактерий. Аминокислотные основания консервативного мотива Q-петли, участвующие
в формировании сайта связывания глутамина, выделены желтым цветом; замена оснований R/K
в этом мотиве выделена зеленым цветом.
Q-петля у членов сем. Brassicaceae содержит делецию в три аминокислоты,
с чем может быть связана глутамин-независимая конформация Q-петли. В связи с
этим было сделано предположение, что глутаминовый сигналинг может быть
общей функциональной чертой PII растений, а представители сем. Brassicaceae
являются лишь исключением. Для проверки этого предположения были получены
рекомбинантные белки PII для двух филогенетически удаленных растений – мха
Physcomitrella patens и риса Oryza sativa. Чтобы проанализировать эффект
глутамина, эти PII-белки были добавлены к AtNAGK, ингибированному
аргинином, при возрастающей концентрации глутамина. Анализ ферментативной
активности NAGK показал, что оба белка PII были способны повышать
92
активность ингибированного аргинином AtNAGK по глутамин-зависимому
механизму: PII Physcomitrella с ЕС50 6,6 мМ, а PII Oryza с ЕС50 9,2 мМ (рисунок
36). Эти данные подтверждают
то, что выявленный у зеленых водорослей
глутамин-зависимый ответ является общим свойством PII-белков растений, а
представители сем. Brassicaceae составляют лишь исключение.
Рисунок 36. Зависимость от глутамина способности белков AtPII, OsPII, PpPII активировать
ингибированный аргинином AtNAGK.
93
ГЛАВА 4. ОБСУЖДЕНИЕ РЕЗУЛЬТАТОВ
4.1. Структура и регуляция белков PII
Chlamydomonas reinhardtii и Chlorella variabilis
PII-белки цианобактерий и растений принадлежат к субсемейству GlnB. В
геномах одноклеточных зеленых водорослей Chlamydomonas reinhardtii и
Chlorella variabilis идентифицированы единичные гены, кодирующие GlnBгомологи. Первичная последовательность белков CrPII и CvPII имеет высокий
процент идентичности с первичными последовательностями соответствующих
белков других оксигенных фотосинтезирующих организмов (цианобактерий и
растений) и содержит консервативные консенсусные участки, соответствующие
B, C и Т-петлям (рисунок 16). Кроме того, сохраняются все необходимые сайты
для связывания таких эффекторных молекул как АТФ и 2-ОГ, что предполагает
способность этих белков функционировать в зависимости от энергетического
статуса клетки и соотношения уровней N/C.
Как отмечалось ранее (см. гл. 1), примечательной особенностью PII-белков
фотосинтезирующих эукариот, включая С. reinhrdtii и C.variabilis, является
наличие удлиненных участков на N- и С-концах молекулы. Несмотря на то, что
белок РII у растений (A. thaliana) кодируется ядерными генами, была показана его
хлоропластная локализация (Hsieh et al., 1998; Sugiyama et al., 2004). N-концевая
последовательность PII C. reinhardtii кодирует транзитный пептид, который
определяет локализацию в хлоропласте и отрезается у зрелого белка. Нами было
показано, что как и PII-гомологи высших растений, зрелый CrPII локализован в
хлоропласте (рисунок 11). Что касается CvGLB1, то было выявлено, что
имеющаяся в базе данных последовательность является неполной с N-конца, что
не позволило определить транзитный пептид хлоропластной локализации. В
данной работе определен сиквенс всего гена GLB1 C. variabilis. Последующий
сравнительный анализ аминокислотных последовательностей, а также результаты
иммунодетекции (рисунок 17) предполагают хлоропластную локализацию белка
CvPII. До недавнего времени оставался открытым вопрос о роли С-концевого
94
удлинения в последовательностях PII-белков эукариот. Данные кристаллографии
белка СrPII позволили выявить на С-конце небольшую структуру, Q-петлю
(KMEG), которая оборачивается вокруг связанной молекулы глутамина и
необходима для глутамин-зависимого комплексообразования с N-ацетил-Lглутаматкиназой (Chellamuthu et al., 2014). Аналогичная аминокислотная
последовательность была выявлена в белке CvPII (рисунок 35). Более того,
проведенный
сравнительный
анализ аминокислотных
последовательностей
указывает на то, что в связи с делецией в пределах С-концевого участка PII-белки
представителей сем. Brassicaceae (к которым принадлежит A. thaliana) не
способны связывать глутамин (рисунок 35).
Характерная консервативная последовательность В-петли [ST]-x(3)-G-[DY]G-[KR]-[IV]-[FW]-[LIVM], общая для всех прокариотических белков PII, также
сохраняется у высших растений и одноклеточных зеленых водорослей (рисунок
16). Аминокислоты этой последовательности участвуют во взаимодействии
между мономерами. Структурно PII высших растений и бактерий формирует
функциональный (гомо)тример (Mizuno et al., 2007). Данные гель-фильтрации
рекомбинатных белков CrPII и CvPII показывают, что эти белки также
функционируют как тримеры (рисунок 15, 23).
Регуляция белков в клетках может осуществлять на трех уровнях –
транскрипционном, трансляционном и
посттрансляционном.
Поскольку в
недавних исследования была показана некоторая регуляция белка PII A. thaliana
на уровне транскрипции (Uhrig et al., 2009), нами был проведен тщательный
анализ экспрессии CrPII и CvPII на уровне транскрипции и трансляции.
Полученные результаты указывают на то, что у C. reinhardtii экспрессия CrGLB1
увеличивается в гаметах (рисунок 12A). Известно, что свет необходим для
дифференциации вегетативных клеток Chlamydomonas в компетентные гаметы в
условиях недостатка азота (Beck и Acker, 1992). Свет запускает сигнал
дифференциации прегамет (взятых из темноты и некомпетентных к спариванию)
в функциональные гаметы (Pan et al., 1997). Использование мутанта lrg6,
демонстрирующего формирование компетентных гамет в темноте (без светового
95
сигнала) (Dame et al., 2002), позволило доказать, что зависимая от света
транскрипция CrGLB1 не связана с контролем гаметогенеза. Эти данные
подтверждаются тем фактом, что уровни мРНК CrGLB1 повышаются в 2-3 раза в
течение 2 часов освещения выращенных в темноте вегетативных клеток (рисунок
13А). Кроме того, после удаления из среды азота также происходило временное
возрастание экспрессии CrGLB1 (рисунок 14А). Хотя уровни транскрипции
CrGLB1 несколько повышаются в ответ на освещение клеток и удаление азота из
среды, не было выявлено значительных изменений уровня белка CrPII (рисунок
12Б, 13Б, 14Б).
Предпринятые нами попытки выявить регуляцию синтеза белка PII у C.
variabilis на уровне транскрипции/трансляции не привели к положительным
результатам. Поскольку экспрессия генов ранее не изучалась у Chlorella, была
проведена предварительная работа по выбору референс-гена. В качестве
кандидатов на роль нормализатора, имеющего постоянные уровни экспрессии в
условиях эксперимента, были выбраны гены предполагаемых белков GPD1
(глицеральдегид-3-фосфатдегидрогеназа), EF1A (фактор элонгации 1α), АСТ
(актин),
MDH3
(малатдегидрогеназа),
PYK
(пируваткиназа),
UBI
(убиквитинлигаза Е2) и CBLP (рецептор активируемой протеинкиназы С1).
Экспрессия этих генов была пронализирована у клеток, выращенных на разных
источниках азота и в среде без азота (рисунок 21). Полученные результаты
позволили прийти к заключению, что некоторые из этих генов можно
использовать в качестве нормализаторов только для данных конкретных условий,
тогда как ни один из вышеперечисленных генов не демонстрировал относительно
стабильной экспрессии при росте на разных источниках азота. Однако было
показано, что транскрипция именно CvGLB1 не изменяется при росте на
различных источниках
азота и не зависит от фазы роста (таблица 2). Эти
результаты позволили предложить CvGLB1 в качестве референс-гена для
дальнейшего изучения экспрессии генов метаболизма азота у C. variabilis NC64A.
Среди PII-белков бактерий широко распространена регуляция путем
посттрансляционных модификаций (рисунок 2). У протеобактерий белок PII
96
подвергается уридилированию по остатку Tyr-51 (Magasanik, 1993), который в
белках CrPII и CvPII заменен на фенилаланин. Это указывает на то, что
представители этого семейства у одноклеточных зеленых водорослей не могут
модифицироваться путем уридилирования. Следует отметить, что несмотря на
то,
что
последовательности
цианобактериальных
белков
содержат
PII
консервативный остаток Tyr-51 в этой области, они не подвергаются ковалентной
модификации путем уридилирования. Вместо этого, для PII цианобактерий
характерно
посттрансляционное
фосфорилирование
по
остатку
Ser-49
(Forchhammer и Tandeau de Marsac, 1994). Белки PII растений также содержат
консервативный, но нефосфорилируемый Ser-49, тогда как в последовательности
CrPII
это
место
последовательность
занято
не
остатком
исключает
треонина.
Такая
возможности
аминокислотная
посттрансляционной
модификации путем фосфорилирования. Однако в работе коллег было показано,
что
белок
CrPII
также
не
фосфорилируется
(Ermilova
et
al.,
2013).
Посттрансляционные модификации бактериальных белков PII, как правило,
осуществляются в ответ на изменение соотношения уровней N/C. Однако следует
отметить, что PII-белки зеленых водорослей и большинства высших растений
приобрели уникальную способность непосредственно связывать глутамин,
который в клетках многих организмов является индикатором N/C статуса клетки.
4.2. N-ацетил-L-глутаматкиназы –
мишени белков PII фотосинтезирующих организмов
Белки PII функционируют за счет белок-белковых взаимодействий,
контролируя широкий спектр мишеней в клетке, включающих ферменты,
транскрипционные факторы и белки-транспортеры. У фотосинтезирующих
организмов в процессе эволюции появилась уникальная мишень, контролируемая
PII-белками,
–
ключевой
фермент
биосинтеза
аргинина
–
N-ацетил-L-
глутаматкиназа (NAGK) (см гл. 1). В геномах C. reinhardtii и C. variabilis были
выявлены гены, кодирующие белки NAGK. Биоинформационный анализ
97
аминокислотных последовательностей CrPII и CvPII, а также CrNAGK и
CvNAGK, показал, что остатки, необходимые для формирования комплекса
между этими белками остаются консервативными у одноклеточных зеленых
водорослей (рисунок 16, 24). Анализ кинетических параметров (Km и Kcat)
позволяет говорить о том, что несмотря на значительное сходство в работе обоих
ферментов, белок NAGK Chlorella характеризуется несколько более медленной
скоростью ферментативных превращений, но большей чувствительностью к
субстрату NAG в сравнении с NAGK Chlamydomonas.
Ранее было показано, что у цианобактерий и высших растений NAGK
ингибируется аргинином и PII приводит к ослаблению этого ингибирующего
действия в зависимости от наличия азота и АТФ (Beez et al., 2009). Нами было
показано, что подобная регуляция характерна и для белков C. reinhardtii и C.
variabilis. Однако было установлено, что значение половины максимальной
ингибирующей концентрации аргинина (IC50) для белка CvNAGK оказалось
приблизительно в 10 раз выше, чем для CrNAGK. Кроме того, в данной работе с
использованием рекомбинантных белков PII и NAGK на одноклеточных зеленых
водорослях C. reinhardtii и C. variabilis впервые было показано, что для
эффективного ослабления ингибирующего действия аргинина на
NAGK
необходим глутамин. При изучении этой уникальной особенности белков CrPII и
CvPII эффективные значения для глутамина были найдены в миллимолярном
диапазоне (EC506,5 ± 1,1 мМ и 4,6 ± 2,4 мМ). Анализ комплексов PII-NAGK
одноклеточных зеленых водорослей в присутствии глутамина, показал, что как и
у цианобактерий и растений, PII имеет только незначительный эффект на
каталитические константы NAGK в отсутствии аргинина, тогда как основная
функция PII проявляется в модуляции ингибирования NAGK аргинином.
Зависимость способности к образованию комплекса CvPII-CvNAGK от
глутамина была дополнительно подтверждена данными гель-фильтрации смеси
этих белков в присутствии или отсутствии молекул-эффекторов (рисунок 26).
Было показано, что только глутамин позволяет белкам принимать нужную
конформацию для стабильного образования комплекса. Интересным оказался тот
98
факт, что ключевая молекула-эффектор, 2-ОГ, которая приводит к диссоциации
комплекса у цианобактерий, у C. variabilis и C. reinhardtii не оказывала никакого
влияния на образование PII-NAGK. Однако анализ каталитической активности
комплекса NAGK-PII одноклеточных зеленых водорослей показал, что 2-ОГ не
позволяет белку PII снимать ингибирующее действие аргинина на NAGK даже в
присутствии
глутамина.
Причем
половина
максимальной
ингибирующей
концентрации 2-ОГ для деактивации NAGK (IC50) C. variabilis оказалась в 5 раз
ниже, чем для белка C. reinhardtii, что может отражать разницу физиологических
концентраций 2-ОГ в клетках этих микроорганизмов и, как следствие, адаптацию
PII-белков.
В ходе дальнейших исследований были получены доказательства того, что
глутамин может контролировать уровни аргинина в условиях
in vivo.
Одноклеточная зеленая водоросль C. variabilis NC64A оказалась удобным
модельным объектом для изучения этого вопроса по причине использования
глутамина
в
ассимиляция
качестве
не
предпочтительного
сопровождается
источника
внеклеточным
азота,
причем
деаминированием
его
этой
аминокислоты, как это происходит у C. reinhardtii. Согласно полученным нами
данным концентрации глутамина, обеспечивающие активный рост Chlorella,
близки к тем концентрациям, которые были определены как эффективные для PIIопосредованной активации CvNAGK(рисунок 32). В условиях роста на среде с 10
мМ глутамина, уровни аргинина остаются высокими (рисунок 33). Однако когда
глутамин исчерпан в стационарной фазе, внутриклеточные уровни аргинина
уменьшается. Подобный, но менее выраженный эффект глутамина на накопление
аргинина наблюдался в среде с 2 мМ глутамина. Содержание аргинина в
культурах, выращенных на 2 мМ глутамина, было приблизительно в 2 раза ниже,
чем в культурах, выращенных на 10 мМ глутамина (рисунок 33). Кроме того,
уровни аргинина в клетках, растущих на MBBM, значительно ниже, чем когда
клетки растут на средах, содержащих глутамин. Эти результаты позволяют
предположить, что в присутствии глутамина уровни внутриклеточного аргинина
увеличиваются. Кроме того, измерения общей активности глутаминсинтетаз
99
показали, что значения ферментативных активностей отрицательно коррелируют
с уровнем глутамина в среде (рисунок 33). Ингибирование экспрессии и
активности GS глутамином имеет физиологический смысл для Chlorella: более
низкой активности фермента достаточно для обеспечения клеток аминокислотой в
условиях ее транспорта из среды. На сегодняшний день эти результаты являются
первым сообщением о том, что глутамин в среде опосредует контроль
глутаминсинтетаз у фотосинтезирующих протистов. Семейство генов GS С.
variabilis NC64 достаточно простое и содержит только один ген, кодирующий
цитозольную форму фермента, обозначенную CvGS1, и CvGS2, кодирующий
пластидный полипептид. В отличие от C. reinhardtii (Chen и Silflow, 1996),
аммоний не влияет на уровни экспрессии обоих CvGS C. variabilis (рисунок 34).
При росте на глутамине, транскрипция CvGS1 и CvGS2 остается практически
постоянной. Добавление ингибитора глутаминсинтетаз MSX неожиданно сильно
повышало индукцию обоих генов CvGS, что указывает на наличие механизма
координации
ассимиляции
глутамина
с
его
синтезом.
Было
сделано
предположение о том, что репрессия генов CvGS строго зависит от клеточных
концентраций глутамина. Таким образом, мы установили, что поток глутамата в
путь, который опосредует пул аргинина, по-видимому, регулируется уровнем
глутамина через белок PII. Только при высоких уровнях глутамина, которые
указывают на достаточное количество азота, происходит синтез запасных
соединений азота. По нашим данным, это первый пример глутамин-зависимой
связи метаболизма и сигналинга у одноклеточных эукариот.
Поскольку для единственного ранее изученного растения A. thaliana не
было описано выявленного нами глутамин-зависимого контроля активности PII
при его взаимодействии с NAGK, возник вопрос о распространенности
выявленного глутамин-зависимого механизма среди других растений. Для этой
цели были получены и проанализированы рекомбинантные белки PII двух
филогенетически удаленных организмов – мха Physcomitrella patens и риса Oryza
sativa. Было показано, что как и PII белки зеленых водорослей, PpPII и OsPII
способны
активировать
ингибированный
аргинином
AtNAGK
только
в
100
присутствии глутамина, причем по зависимому от концентрации механизму
(рисунок 36). Эти данные указывают на то, что выявленная для одноклеточных
зеленых водорослей способность белка PII связывать глутамин широко
распространена среди растений. Исключение составляют лишь PII-белки
представителей сем. Brassicaceae, что, как уже отмечалось, вероятно, связано с
небольшой делецией в Q-петле (рисунок 35).
Следует отметить, что эффективные концентрации глутамина для всех
проанализированных организмов находятся в миллимолярном диапазоне (2,5-20
мM), что хорошо согласуется с литературными данными по физиологическим
концентрациям глутамина для различных видов растений, таких как табак,
шпинат, ячмень (Fritz et al., 2006; Riens et al., 1991; Winter et al., 1993; Winter et al.,
1994). В связи с этим, связывание глутамина с PII может иметь регуляторное
значение для клеток, приводя к эффективной активации NAGK и снятию
ингибирования аргинином. Только при высоких уровнях глутамина, которые
указывают на достаточное количество азота, синтез запасных соединений азота
будет функционально обоснован для клетки. Селективное давление, которое
привело к глутамин-нечувствительным белкам PII сем. Brassicaceae, неизвестно,
но это может указывать на наличие особенностей метаболизма азота у этого
семейства растений. Глутамин является основным репортером азотного статуса у
многих бактерий (Forchhammer, 2007). Информация о глутаминовом статусе
клетки воспринимается PII-сигнальной системой через глутамин-чувствительные
ферменты модификации, такие как уридилтрансфераза/деуридилаза у E.coli (Adler
et al., 1975; Jiang и Ninfa, 2011). В развитии хлоропластов зеленых водорослей от
цианобактериальных предков, эволюция вновь изобрела способность к детекции
глутамина через небольшое С-концевое удлинение PII-сигнальных трансдукторов.
Последняя структурная черта позволяет глутамину контролировать функции PII
через сложную сеть межбелковых взаимодействий. Выявленный факт является
примером конвергентной эволюции одного из наиболее распространенных в
природе сигнальных белков.
101
ЗАКЛЮЧЕНИЕ
Анализ структуры и функции белков из семейства PII у одноклеточных
зеленых водорослей Chlamydomonas reinhardtii и Chlorella variabilis позволил
прийти к следующему заключению.
Впервые для представителей одноклеточных эукариот выявлены и
охарактеризованы белки из консервативного семейства сигнальных белков PII,
которые демонстрируют высокую степень идентичности с белками бактерий и
растений. Полученные результаты указывают на то, что белки CrPII и CvPII,
кодируемые ядерными генами, локализованы в хлоропластах. В первичной
последовательности изученных белков сохраняются консервативные основания,
необходимые для связывания молекул-эффекторов (АТФ, 2-ОГ) и формирования
тримерных структур. Кроме того, экспериментально полученные данные также
подтверждают,
что
PII-белки
одноклеточных
зеленых
водорослей
функционируют как тримеры.
Экспрессия
гена
CrGLB1,
кодирующего
PII-белок
Chlamydomonas,
контролируется светом и отсутствием азота в среде, что не сопровождается,
однако, значительными изменениями в уровнях самого белка. Установлено также,
что экспрессия CrGLB1 не контролируется регуляторами гаметогенеза. Напротив,
экспрессия гена CvGLB1, как и у большинства изученных ранее генов
субсемейства glnB, не зависит от присутствия источников азота, а также не
изменяется в зависимости от фазы роста. Полученные данные позволили
предложить ген CvGLB1 в качестве референс-гена для изучения экспрессии генов
Chlorella.
В ходе выполнения исследования нами был получен фактический материал,
показывающий, что ключевой фермент биосинтеза аргинина – N-ацетил-Lглутаматкиназа (NAGK), активность которого у цианобактерий и высших
растений контролируется PII, является также мишенью PII-белков одноклеточных
зеленых водорослей C. reinhardtii и C. variabilis. Анализ каталитической
активности белков CrNAGK и CvNAGK позволяет говорить о сходных
102
ферментативных возможностях, а имеющиеся отличия, вероятнее всего,
отражают особенности метаболизма Chlamydomonas и Chlorella.
Полученные данные подтверждают высказанную ранее гипотезу о том, что
PII-зависимая регуляция NAGK консервативна у организмов с оксигенным типом
фотосинтеза. Однако на примере одноклеточных зеленых водорослей впервые
было показано, что для снятия ингибирующего действия аргинина на NAGK,
белки PII фотосинтезирующих эукариот нуждаются в глутамине. Наличие
консервативной
Q-петли
на
С-конце
PII-белков
высших
растений,
не
принадлежащих к сем. Brassicaceae, указывает на то, что глутаминовый
сигналинг может быть общей функциональной чертой PII растений. Для проверки
этого предположения, нами были получены рекомбинантные белки PII для двух
филогенетически удаленных представителей
– Physcomitrella patens и Oryza
sativa. Показано, что оба PII-белка контролировали NAGK по глутаминзависимому механизму (рисунок 37).
Рисунок 37. Схема, показывающая PII-зависимый контроль биосинтеза аргинина по глутаминзависимому и глутамин-независимому механизму.
103
Т.о, наши данные предполагают, что в эволюции хлоропластов зеленых
водорослей от цианобактериальных предков, появился новый механизм рецепции
глутамина с помощью небольшого С-концевого удлинения PII-сигнальных
трансдукторов.
104
ВЫВОДЫ
1. Одноклеточные зеленые водоросли Chlamydomonas reinhardtii и Chlorella
variabilis содержат сигнальные белки, относящиеся к субсемейству GlnB
PII-белков, которые кодируются у них единичными ядерными генами
CrGLB1 и CvGLB1; полная нуклеотидная последовательность последнего
определена (GenBank: KJ524571) и состоит из шести интронов и семи
экзонов.
2. Транскрипция CrGLB1 контролируется светом и отсутствием азота в среде и
не регулируется в процессе гаметогенеза. Транскрипция CvGLB1 не зависит
от условий культивирования клеток; ген предложен в качестве первого
референс-гена для проведения ПЦР в реальном времени у C. variabilis.
3. Функционально активные белки PII C. reinhardtii (CrPII) и C. variabilis
(CvPII) локализованы в хлоропластах и, подобно белкам прокариот и
высших растений, образуют гомотримеры.
4. N-ацетил-L-глутаматкиназа (NAGK) является мишенью для белков CrPII и
CvPII,
которые
формируют
комплекс
с
гексамером
фермента
и
контролируют его активность.
5. Белки CrPII и CvPII регулируют активность NAGK по глутамин-зависимому
механизму.
105
БЛАГОДАРНОСТИ
Выражаю глубокую благодарность своему научному руководителю Елене
Викторовне Ермиловой за неоценимую помощь на всех этапах выполнения
работы.
Также
выражаю
глубокую
признательность
старшим
научным
сотрудникам лаборатории адаптации микроорганизмов – Залуцкой Жаннете
Михайловне и Лапиной Татьяне Викторовне за огромную помощь в выполнении
экспериментальной части работы.
Большую благодарность выражаю сотрудникам кафедры микробиологии
Санкт-Петербургского государственного университета во главе с заведующим
Александром Васильевичем Пиневичем.
Искреннюю признательность выражаю проф. Карлу Форчхаммеру и
коллективу его лаборатории в Университете г. Тюбинген (Германия) за
возможность выполнения части экспериментов и обсуждение полученных
результатов.
Выражаю благодарность сотрудникам ресурсных центров «Развитие
молекулярных и клеточных технологий» и «Хромас» Санкт-Петербургского
госудврственного университета.
Искренне благодарю за оказанную помощь и ценные советы сотрудника
ГНУ ВНИИ Сельхозмикробиологии Евгения Евгеньевича Андронова.
В завершение благодарю свою семью за помощь, понимание и поддержку.
106
СПИСОК СОКРАЩЕНИЙ
АТФ – аденозинтрифосфат
АДФ – аденозиндифосфат
АМФ – аденозинмонофосфат
УМФ – уридилмонофосфат
НАД+ – никотинамид-адениндинуклеотид (окисленная форма)
НАДН – никотинамид-адениндинуклеотид (восстановленная форма)
НАДФ+ – никотинамидадениндинуклеотид-фосфат (окисленная форма)
НАДФН – никотинамидадениндинуклеотид-фосфат (восстановленная форма)
GS – глутаминсинтетаза
FBI-GS – обратимо ингибированная глутаминсинтетаза
GOGAT – глутамат-2-оксоглутарат-аминотрансфераза
GS/GOGAT путь – глутаминсинтетазный/глутаматсинтетазный путь
GDH – глутаматдегидрогеназный путь
AT – аденилилтрансфераза
2-ОГ – 2-оксоглутарат
Gln – глутамин
BCCP – biotin carboxyl carrier protein
ACCаза – ацетил-CoA карбоксилаза
NAGK – N-ацетил-L-глутаматкиназа
NAG – N-ацетилглутамат
ПААГ – полиакриламидный гель
кДНК – комплиментарная ДНК
CDS – кодирующая последовательность ДНК
ПЦР – полимеразная цепная реакция
ОТ-ПЦР – полимеразная цепная реакция с обратной транскрипцией
-N – без азота
StrepCrPII-tp – рекомбинантный белок PII С. reinhardtii без последовательности
транзитного пептида, конъюгированный со StrepII-тагом на C-конце
107
StrepCvPII-tp – рекомбинантный белок PII С. variabilis без последовательности
транзитного пептида, конъюгированный со StrepII-тагом на C-конце
StrepPpPII-tp – рекомбинантный белок PII P. patens без последовательности
транзитного пептида, конъюгированный со StrepII-тагом на C-конце
StrepOsPII-tp – рекомбинантный белок PII O. sativa без последовательности
транзитного пептида, конъюгированный со StrepII-тагом на C-конце
His6CvNAGK-tp
–
последовательности
рекомбинантный
транзитного
белок
пептида,
variabilis
без
конъюгированный
с
NAGK
С.
полигистидиновым тагом на N-конце
His6AtNAGK-tp
–
последовательности
рекомбинантный
транзитного
белок
пептида,
thaliana
без
конъюгированный
с
NAGK
A.
полигистидиновым тагом на N-конце
GPD1 – глицеральдегид-3-фосфатдегидрогеназа
EF1A – фактор элонгации 1α
АСТ – актин
MDH3 – малатдегидрогеназа
PYK – пируваткиназа
UBI – убиквитинлигаза Е2
CBLP – рецептор активируемой протеинкиназы С1
CV – коэффициентом вариации
MFC – отношение максимального и минимального значения, наблюдаемого в
наборе данных
MSX – метионин-DL-сульфоксимин
IC50 – половина ингибирующей концентрации
EC50 – половина эффективной концентрации
108
СПИСОК ЛИТЕРАТУРЫ
1. Ермилова, Е.В. Молекулярные аспекты адаптации прокариот: монография /
Е.В. Ермилова. – 2-е изд., Санкт-Петербург: Химиздат, 2012. – 342 с.
2. Adler, S.P. Cascade control of Escherichia coli glutamine synthetase. Properties
of the PII regulatory protein and the uridylyltransferase/uridylyl-removing
enzyme / S. P. Adler, D. Purich, E.R. Stadtman // J Biol Chem. – 1975. – Vol.
250. – P. 6264-6272.
3. Arcondéguy, T. The PII signal transduction proteins: pivotal players in microbial
nitrogen control / T. Arcondéguy, R. Jack, M. Merrick // Microbiol Mol Biol Rev.
– 2001. – Vol. 65. – P. 80-105.
4. Arnon, D.I. Copper enzymes in isolated chloroplasts: polyphenol oxidase in Beta
vulgaris / D.I. Arnon // Plant Physiol. – 1949. – Vol. 24. – P. 1-15.
5. Beck, C. Gametic differentiation of Chlamydomonas reinhardtii / C. Beck and A.
Acker // Plant Physiol. – 1992. – Vol. 98. – P. 822-826.
6. Beckers, G. Regulation of AmtR-controlled gene expression in Corynebacterium
glutamicum: Mechanism and characterization of the AmtR regulon / G. Beckers,
J. Strösser, U. Hildebrandt, J. Kalinowski, M. Farwick, R. Krämer, A. Burkovski
// Mol Microbiol. – 2005. – 58. – P. 580-595.
7. Beez, S. N-Acetyl-L-glutamate kinase (NAGK) from oxygenic phototrophs: PII
signal transduction across domains of
life reveals novel insights in NAGK
control / S. Beez, O. Fokina, C. Herrmann, K. Forchhammer // J Mol Biol. –
2009. – Vol. 389. – 748–758.
8. Benelli, E.M. Evidence for two possible glnB-type genes in Herbaspirillum
seropedicae / E.M. Benelli, E.M. Souza, S. Funayama, I.U. Rigo, F.O. Pedrosa //
Bacteriol. – 1997. – Vol. 179. – P. 4623-4626.
9. Blanc, G. The Chlorella variabilis NC64A genome reveals adaptation to
photosymbiosis, coevolution with viruses, and cryptic sex / G. Blanc, G. Duncan,
I. Agarkova, M. Borodovsky, J. Gurnon, A. Kuo, E. Lindquist, S. Lucas, J.
109
Pangilinan, J. Polle, A. Salamov, A. Terry, T. Yamada, D.D. Dunigan, I.V.
Grigoriev, J.M. Claverie, J.L. van Etten // J Plant Cell. – 2010. – Vol. 22. – P.
2943-2955.
10. Brown, G.D. Isolation and characterisation of an aryl-beta-D-glucoside uptake
and utilisation system (abg) from the grampositive ruminal Clostridium species
C. longisporum / G.D. Brown and J.A. Thomson // Mol Gen Genet. – 1998. –
Vol. 257. – P. 213-218.
11. Bueno, R. Role of glnB and glnD gene products in regulation of the glnALG
operon of Escherichia coli / R. Bueno, G. Pahel, B. Magasanik // J Bacteriol. –
1985. – Vol. 164. – 816-822.
12. Burillo, S. Interactions between the nitrogen signal transduction protein PII and
N-acetyl-L-glutamate kinase in organisms that perform oxygenic photosynthesis.
S. Burillo, I. Luque, I. Fuentes, A. Contreras // Bacteriol. – 2004. – Vol. 186. – P.
3346-3354.
13. Burkovski, A. Nitrogen control in Corynebacterium glutamicum: proteins,
mechanisms, signals / A. Burkovski // J Microbiol Biotechnol. – 2007. – Vol. 17.
– № 2. – P. 187-194.
14. Chellamuthu, V.R. A widespread glutamine-sensing mechanism in the plant
kingdom / V.R. Chellamuthu, E. Ermilova, T. Lapina, J. Lüddecke, E. Minaeva,
C. Herrmann, M.D. Hartmann, K. Forchhammer // Cell. – 2014. – Vol. 159. – P.
1188-1199.
15. Chellamuthu, V.R. From cyanobacteria to plants: conservation of PII functions
during plastid evolution / V.R. Chellamuthu, V. Alva, K. Forchhammer // Planta.
– 2013. – Vol. 237. – P. 445-462.
16. Chen, Q. Isolation and characterization of glutamine synthetase genes in
Chlamydomonas reinhardtii / Q. Chen and C.D. Silflow // Plant Physiol. – 1996.
– Vol. 112. – P. 987-996.
17. Chen, Y.M. The PII signal transduction protein of Arabidopsis thaliana forms an
arginine-regulated complex with plastid N-acetyl-L-glutamate kinase / Y.M.
110
Chen, T.S. Ferrar, E.M. Lohmeier-Vogel, N. Morrice, Y. Mizuno, B. Berenger,
K.K. Ng, D.G. Muench, G.B. Moorhead // J Biol Chem. – 2006. – Vol. 281. – P.
5726-5733.
18. Cole, S.T. Deciphering the biology of Mycobacterium tuberculosis from the
complete genome sequence / S.T. Cole, R. Brosch, J. Parkhill, T. Garnier, C.
Churcher, D. Harris, S.V. Gordon, K. Eiglmeier, S. Gas, C.E. Barry 3rd, F.
Tekaia, K. Badcock, D. Basham, D. Brown, T. Chillingworth, R. Connor, R.
Davies, K. Devlin, T. Feltwell, S. Gentles, N. Hamlin, S. Holroyd, T. Hornsby, K.
Jagels, A. Krogh, J. McLean, S. Moule, L. Murphy, K. Oliver, J. Osborne, M.A.
Quail, M.A. Rajandream, J. Rogers, S. Rutter, K. Seeger, J. Skelton, R. Squares,
S. Squares, J.E. Sulston, K. Taylor, S. Whitehead, B.G. Barrell // Nature. – 1998.
– Vol. 393. – P. 537-544.
19. Commichau, F.M. Regulatory links between carbon and nitrogen metabolism /
F.M. Commichau, K. Forchhammer, J. Stülke // Curr Opin Microbiol. – 2006. –
Vol. 9. – P. 167–172.
20. Coutts, G. Membrane sequestration of the signal transduction protein GlnK by
the ammonium transporter AmtB / G. Coutts, G. Thomas, D. Blakey, M. Merrick
// EMBO J. – 2002. – Vol. 21. – P. 536-545.
21. Dame, G. Knock-out of a putative transporter results in altered blue light
signalling in Chlamydomonas / G. Dame, G. Gloecker, C.F. Beck // Plant J. –
2002. – Vol. 31. – 577-587.
22. De Jonge, H.J. Evidence based selection of housekeeping genes / H.J. de Jonge,
R.S. Fehrmann, E.S. de Bont, R.M. Hofstra, F. Gerbens, W.A. Kamps, E.G. de
Vries, A.G. Van der Zee, G.J. te Meerman, A. ter Elst // PloS One. – 2007. – Vol.
2. – e898.
23. Detsch, C. Ammonium utilization in Bacillus subtilis: Transport and regulatory
functions of NrgA and NrgB / C. Detsch and J. Stülke // Microbiol. – 2003. –
Vol. 149. – P. 3289-3297.
111
24. Dodsworth, J.A. Regulation of nitrogenase by 2-oxoglutarate-reversible, direct
binding of a PII-like nitrogen sensor protein to dinitrogenase / J.A. Dodsworth
and J.A. Leigh // Proc Natl Acad Sci USA. – 2006. – Vol. 103. – P. 9779-9784.
25. Emanuelsson, O. ChloroP, a neural network-based method for predicting
chloroplast transit peptides and their cleavage sites / O. Emanuelsson, H. Nielsen,
G. von Heijne // Prot Sci. – 1999. – Vol. 8. – P. 978-984.
26. Emanuelsson, O. Locating proteins in the cell using TargetP, SignalP, and
related tools ChloroP, a neural network-based method for predicting chloroplast
transit peptides and their cleavage sites / O. Emanuelsson, S. Brunak, G. von
Heijne, H. Nielsen // Nature Protocols. – 2007. – Vol. 2. – P. 953-971.
27. Ermilova, E. PII signal transduction protein in Chlamydomonas reinhardtii:
localization and expression pattern / E. Ermilova, T. Lapina, Z. Zalutskaya, E.
Minaeva, O. Fokina, K. Forchhammer // Protist. – 2013. – Vol. 164. – P. 49-59.
28. Ermilova, E.V. Characterization of phototropincontrolled signaling components
that regulate chemotaxis towards ammonium in Chlamydomonas / E.V. Ermilova,
Z.M. Zalutskaya, D.M. Baibus, C.F. Beck // Protistology. – 2006. – Vol. 4. – P.
301-310.
29. Ermilova, E.V. Phototropin plays a crucial role in controlling changes in
chemotaxis during the initial phase of the sexual life cycle in Chlamydomonas /
E.V. Ermilova, Zh.M. Zalutskaya, K. Huag, C.F. Beck // Planta. – 2004. – Vol.
219. – P. 420-427.
30. Espinosa, J. Interaction network in cyanobacterial nitrogen regulation: PipX, a
protein that interacts in a 2-oxoglutarate dependent manner with PII and NtcA / J.
Espinosa, K. Forchhammer, S. Burillo, A. Contreras // Mol Microbiol. – 2006. –
Vol. 61. – P. 457-469.
31. Espinosa, J. PipX, the coactivator of NtcA, is a global regulator in cyanobacteria
/ J. Espinosa, F. Rodríguez-Mateos, P. Salinas, V.F. Lanza, R. Dixon, F. de la
Cruz, A. Contreras
E2423-2430.
//
Proc Natl Acad Sci USA. – 2014. – Vol. 111. – № 23. –
112
32. Espinosa, J. Role of Synechococcus PCC 7942 nitrogen regulatory protein PipX
in NtcA-controlled processes / J. Espinosa, K. Forchhammer, A. Contreras //
Microbiology. – 2007. – Vol. 153. – P. 711-718.
33. Feria Bourrellier, A.B. Chloroplast acetyl-CoA carboxylase activity is 2oxoglutarate-regulated by interaction of PII with the biotin carboxyl carrier
subunit / A.B. Feria Bourrellier, B. Valot, A. Guillot, F. Ambard-Bretteville, J.
Vidal, M. Hodges // Proc Natl Acad Sci USA. – 2010. – Vol. 107. – P. 502-507.
34. Ferrario-Méry, S. Chloroplast nitrite uptake is enhanced in Arabidopsis PII
mutants / S. Ferrario-Méry, C. Meyer, M. Hodges // FEBS Lett. – 2008. – Vol.
582. – P. 1061-1066.
35. Ferrario-Méry, S. Physiological characterization of Arabidopsis mutants affected
in the expression of the putative regulatory protein PII / S. Ferrario-Méry, M.
Bouvet, O. Leleu, G. Savino, M. Hodges, C. Meyer // J Planta. – 2005. – Vol.
223. – P. 28-39.
36. Fisher, S.H. Regulation of nitrogen metabolism in Bacillus subtilis: vive la
différence! / S.H. Fisher // Mol Microbiol. – 1999. – Vol. 32. – P. 223-232.
37. Forchhammer, K. Functional analysis of the phosphoprotein PII from the
cyanobacterium Synechococcus sp. strain PCC 7942 / K. Forchhammer and N.
Tandeau de Marsac // Bacteriol. – 1995. – Vol. 177. – P. 2033-2040.
38. Forchhammer, K. Global carbon/nitrogen control by PII signal transduction in
cyanobacteria: from signals to targets / K. Forchhammer // FEMS Microbiol Rev.
– 2004. – Vol. 28. – P. 319-333.
39. Forchhammer, K. Glutamine signalling in bacteria / K. Forchhammer // Front
Biosci. – 2007. – Vol. 12. – P. 358-370.
40. Forchhammer, K. P(II) signal transducers: novel functional and structural
insights / K. Forchhammer // Trends Microbiol. – 2008. – Vol. 16. – P. 65-72.
41. Forchhammer, K. Phosphoprotein PII from cyanobacteria: analysis of functional
conservation to the PII signals transduction protein from Escherichia coli / K.
Forchhammer and A. Hedler // Eur J Biochem. – 1997. – Vol. 244. – P. 869-875.
113
42. Forchhammer, K. The network of P(II) signaling protein interactions in
unicellular cyanobacteria / K. Forchhammer // Adv Exp Med Biol. – 2010. – Vol.
675. – P. 71-90.
43. Forchhammer, K. The PII protein in Synechococcus PCC 7942 senses and
signals 2-oxoglutarate under ATP-replete conditions. In: The Phototrophic
Prokaryotes / Peschek, G., Loffelhardt, W. and Schmetterer, G., Eds. // New
York: Kluwer Academic. – 1999. – P. 549-553.
44. Forchhammer, K. The PII protein in the cyanobacterium Synechococcus sp.
strain PCC7942 is modified by serine phosphorylation and signals the cellular N
status / K. Forchhammer and N. Tandeau de Marsac // Bacteriol. – 1994. – Vol.
176. – P. 84-91.
45. Fritz, C. Impact of the C-N status on the amino acid profile in tobacco source
leaves / C. Fritz, C. Mueller, P. Matt, R. Feil, M. Stitt // Plant Cell Environ. –
2006. – Vol. 29. – P. 2055-2076.
46. Gerhardt, E.C. The bacterial signal transduction protein GlnB regulates the
committed step in fatty acid biosynthesis by acting as a dissociable regulatory
subunit of acetyl-CoA carboxylase / E.C. Gerhardt, T.E. Rodrigues, M. MüllerSantos, F.O. Pedrosa, E.M. Souza, K. Forchhammer, L.F. Huergo // Mol
Microbiol. – 2015. – Vol. 95. – № 6. – P. 1025-1035.
47. Gibson, D.G. Enzymatic assembly of DNA molecules up to several hundred
kilobases / D.G. Gibson, L. Young, R.Y. Chuang, J.C. Venter, C.A. Hutchison
3rd, H.O. Smith // Nat Methods. – 2009. – Vol. 6. – P. 343-345.
48. González-Ballester, D. Restriction enzyme site-directed amplification PCR: A
tool to identify regions flanking a marker DNA / D. González-Ballester, D.A.
Montaigu, A. Gálvan, E. Fernández // J Anal Biochem. – 2005. – Vol. 340. – P.
330-335.
49. Gorman, D.S. Cytochrome and plastocyanin: their sequences in the
photosynthetic electron transport chain of Chlamydomonas reinhardtii / D.S.
114
Gorman and R.P. Levine // J Proc Natl Acad Sci USA. – 1965. – Vol. 54. – P.
1665-1669.
50. Gunka, K. Control of glutamate homeostasis in Bacillus subtilis: a complex
interplay between
ammonium assimilation, glutamate
biosynthesis
and
degradation / K. Gunka and F.M. Commichau // Mol Microbiol. – 2012. – Vol.
85. – № 2. – 213-224.
51. Harrison, M.A. Modification of a glnB-like gene product by photosynthetic
electron transport in the cyanobacterium Synechococcus 6301/ M.A. Harrison,
J.N. Keen, J.B. Findlay, J.F. Allen // FEBS Lett. – 1990. – Vol. 264. – P. 25-28.
52. Heinrich, A. Interaction of the membrane-bound GlnK-AmtB complex with the
master regulator of nitrogen metabolism TnrA in Bacillus subtilis / A. Heinrich,
K. Woyda, K. Brauburger, G. Meiss, C. Detsch, J. Stülke, K. Forchhammer // J
Biol Chem. – 2006. – Vol. 281. – P. 34909-34917.
53. Heinrich, A. The Synechococcus elongatus PII signal transduction protein
controls arginine synthesis by complex formation with N-acetyl-L-glutamate
kinase / A. Heinrich, M. Maheswaran, U. Ruppert, K. Forchhammer // Mol
Microbiol . – 2004. – Vol. 52. – P. 1303-1314.
54. Hesketh, A. The GlnD and GlnK homologues of Streptomyces coelicolor A3(2)
are functionally dissimilar to their nitrogen regulatory system counterparts from
enteric bacteria / A. Hesketh, D. Fink, B. Gust, H.-U. Rexer, B. Scheel, K.
Chater, W. Wohlleben, A. Engels // Mol Microbiol. – 2002. – Vol. 46. – P. 319330.
55. Hisbergues, M. Protein PII regulates both inorganic carbon and nitrate uptake
and is modified by a redox signal in Synechocystis PCC 6803 / M. Hisbergues, R.
Jeanjean, F. Joset, N. Tandeau de Marsac, S. Bedu // FEBS Lett. – 1999. – Vol.
463. – P. 216-220.
56. Hsieh, M.H. A PII-like protein in Arabidopsis: putative role in nitrogen sensing /
M.H. Hsieh, H.M. Lam, F.J. van de Loo, G. Coruzzi // Proc Natl Acad Sci USA.
– 1998. – Vol. 95. – P. 13965-13970.
115
57. Huergo, L.F. PII signal transduction proteins: pivotal players in posttranslational
control of nitrogenase activity / L.F. Huergo, F.O. Pedrosa, M. Muller-Santos,
L.S. Chubatsu, R.A. Monteiro, M. Merrick, E.M. Souza // Microbiol. – 2012. –
Vol. 158. – P. 176-190.
58. Irmler, A. Dephosphorylation of the phosphoprotein PII in Synechococcus PCC
7942: identification of an ATP and 2-oxoglutarate-regulated phosphatase activity
/ A. Irmler, S. Sanner, H. Dierks, K. Forchhammer // Mol Microbiol. – 1997. –
Vol. 26. – P. 81-90.
59. Jakoby, M. AmtR, a global repressor in the nitrogen regulation system of
Corynebacterium glutamicum / M. Jakoby, L. Nolden, J. Meier-Wagner, R.
Krämer, A. Burkovski // Mol Microbiol . – 2000. – Vol. 37. – P. 964-977.
60. Jakoby, M. Nitrogen regulation in Corynebacterium glutamicum: Isolation of
genes involved and biochemical characterization of corresponding proteins / M.
Jakoby, R. Krämer, A. Burkovski // FEMS Microbiol Lett. – 1999. – Vol. 173. –
303-310.
61. Javelle, A. Ammonium sensing in Escherichia coli. Role of the ammonium
transporter AmtB and AmtB-GlnK complex formation / A. Javelle, E. Severi, J.
Thornton, M. Merrick // J Biol Chem. – 2004. – Vol. 279. – P. 8530-8538.
62. Javelle, A. Ammonium sensing in Escherichia coli. Role of the ammonium
transporter AmtB and AmtB-GlnK complex formation / A. Javelle, E. Severi, J.
Thornton , M. Merrick // J Biol Chem. – 2003. – Vol. 279. – № 10. – 8530-8538.
63. Jiang, P. A source of ultra sensitivity in the glutamine response of the bicyclic
cascade system controlling glutamine synthetase adenylylation state and activity
in Escherichia coli / P. Jiang and A.J. Ninfa // Biochemistry. – 2011. – Vol. 50. –
P. 10929-10940.
64. Jiang, P. Escherichia coli PII signal transduction protein controlling nitrogen
assimilation acts as a sensor of adenylate energy charge in vitro / P. Jiang and
A.J. Ninfa // Biochemistry. – 2007. – Vol. 46. – P. 12979-12996.
116
65. Kamako, S.I. Establishment of axenic endosymbiotic strains of Japanese
Paramecium bursaria and the utilization of carbohydrate and nitrogen
compounds by the isolated algae / S.I. Kamako, R. Hoshina, S. Ueno, N.
Imamura // Eur J Protistol. – 2005. – Vol. 4. – P. 193-202.
66. Kato, Y and Imamura, N. Metabolic сontrol between the symbiotic Chlorella and
the host Paramecium. In: Endosymbionts in Paramecium / Fujishima, M., Eds. //
New York, Dordrecht, Heidelberg, London: Springer. – 2009. – P. 57–81.
67. Kayumov, A. Inactivation of the general transcription factor TnrA in Bacillus
subtilis by proteolysis / A. Kayumov, A. Heinrich, M. Sharipova, O. Iljinskaya,
K. Forchhammer // Microbiol. – 2008. – Vol. 154. – P. 2348-2355.
68. Kayumov, A. Interaction of the general transcription factor TnrA with the PIIlike protein GlnK and glutamine synthetase in Bacillus subtilis / A. Kayumov, A.
Heinrich, K. Fedorova, O. Iljinskaya, K. Forchhammer // FEBS J. – 2011. – Vol.
278. – P. 1778-1789.
69. Kessler, P.S. Genetics of nitrogen regulation in Methanococcus maripaludis /
P.S. Kessler and J.A. Leigh Genetics. – 1999. – Vol. 152. – P. 1343-1351.
70. Klein, U. Cellular fractionation of Chlamydomonas reinhardii with emphasis on
the isolation of the chloroplast / U. Klein, C. Chen, M. Gibbs, K.A. Platt-Aloia //
Plant Physiol. – 1983. – Vol. 72. – P. 481-487.
71. Kloft, N. Signal transduction protein PII phosphatase PphA is required for lightdependent control of nitrate utilization in Synechocystis sp. strain PCC 6803 / N.
Kloft and K. Forchhammer // Bacteriol. – 2005. – 187. – P. 6683-6690.
72. Laemmli, U.K. Cleavage of structural proteins during the assembly of the head
of bacteriophage T4 / U.K. Laemmli // Nature. – 1970. – Vol. 227. – P. 680-685.
73. Laichoubi, K.B. The nitrogen interaction network in Synechococcus WH5701, a
cyanobacterium with two PipX and two PII-like proteins / K.B. Laichoubi, S.
Beez, J. Espinoza, K. Forchhammer, A. Contreras // Microbiol. – 2011. – Vol. V.
– № 157. – P. 1220-1228.
117
74. Lee, H.M. Phosphorylation of the signal transducer PII protein and an additional
effector are required for the PII-mediated regulation of nitrate and nitrite uptake
in the cyanobacterium Synechococcus sp. PCC 7942 / H.M. Lee, E. Flores, K.
Forchhammer, A. Herrero, N. Tandeau de Marsac // Eur J Biochem. – 2000. –
Vol. 267. – P. 591-600.
75. Leigh, J.A. Nitrogen regulation in bacteria and archaea / J.A. Leigh and J.A.
Dodsworth // Annu Rev Microbiol. – 2007. – Vol. 61. – P. 349-377.
76. Liu, Y.G. Efficient isolation and mapping of Arabidopsis thaliana T-DNA insert
junctions by thermal asymmetric interlaced PCR / Y.G. Liu, N. Mitsukawa, T.
Oosumi, R.F. Whittier // Plant J. – 1995. – Vol. 8. –P. 457-463.
77. Llácer, J.L. Arginine and nitrogen storage / J.L. Llácer, I. Fita, V. Rubio // Curr
Opin Struc Biol. – 2008. – Vol. 18. – P. 673-681.
78. Lüddecke, J. Energy sensing versus 2-oxoglutarate dependent ATPase switch in
the control of Synechococcus PII interaction with its targets NAGK and PipX / J.
Lüddecke and K. Forchhammer // PLoS ONE. – 2015. – Vol. 10. – № 8. –
e0137114.
79. Magasanik, B. The regulation of nitrogen utilization in enteric bacteria / B.
Magasanik // Cell Biochem. – 1993. – Vol. 51. – P. 34-40.
80. Maheswaran, M. Complex formation and catalytic activation by the PII signaling
protein of N-acetyl-L-glutamate kinase from Synechococcus elongatus strain PCC
7942 / M. Maheswaran, C. Urbanke, K. Forchhammer // J Biol Chem. – 2004. –
Vol. 279. – P. 55202-55210.
81. Maheswaran, M. PII-regulated arginine synthesis controls accumulation of
cyanophycin in Synechocystis sp. strain PCC 6803 / M. Maheswaran, K. Ziegler,
W. Lockau, M. Hagemann, K. Forchhammer // Bacteriol. –2006. –Vol. 188. – P.
2730-2734.
82. Martin, D.E. Occurrence of three PII-like signal transmitter proteins in the
diazotrophic proteobacterium Azoarcus sp. BH72 / D.E. Martin, T. Hurek and B.
Reinhold-Hurek // Mol Microbiol. – 2000. – Vol. 38. – P. 276-288.
118
83. McAuley, P.J. Uptake of amino acids by cultured and freshly isolated symbiotic
Chlorella / P.J. McAuley // J New Phytol. – 1986. – Vol. 104. – P. 415-427.
84. Minaeva, E. Sequencing and expression analysis of the gene encoding PII signal
protein in Chlorella variabilis NC64A / E. Minaeva and E. Ermilova // J Plant
Biochem Physiol. – 2015. – Vol. 3. – P. 142.
85. Mizuno, Y. Crystal structure of Arabidopsis PII reveals novel structural elements
unique to plants / Y. Mizuno, B. Berenger, G.B. Moorhead, K.K. Ng // Biochem.
–2007а. – Vol. 46. – P. 1477-1483.
86. Mizuno, Y. Structural basis for the regulation of N-acetylglutamate kinase by PII
in Arabidopsis thaliana / Y. Mizuno, G.B. Moorhead, K.K. Ng // Biol Chem. –
2007б. – Vol. 282. – P. 35733-35740.
87. Muños-Blanco,
J.
Extracellular
deamination
of
L
amino
acids
by
Chlamydomonas reinhardtii cells / J. Muños-Blanco, J. Hidalgo Martinez, J.
Cárdenas // Planta. – 1990. – Vol. 182. – P. 194-198.
88. Nichols, H.W. Trichosarcina polymorpha gen.et sp. nov / H.W. Nichols and
H.C. Bold // J Phycol. – 1965. – Vol. 1. – P. 34-38.
89. Ninfa, A.J. PII signal transduction proteins: sensors of alpha-ketoglutarate that
regulate nitrogen metabolism / A.J. Ninfa and P. Jiang // Curr Opin Microbiol. –
2005. – Vol. 8. – P. 168-173.
90. Nolden,
L.
Glutamine
synthetases
of
Corynebacterium
glutamicum:
Transcriptional control and regulation of activity / L. Nolden, M. Farwick, R.
Krämer, A. Burkovski // FEMS Microbiol Lett. – Vol. 201. – P. 91-98.
91. Nolden, L. Sensing nitrogen limitation in Corynebacterium glutamicum: The role
of glnK and glnD / L. Nolden, C.-E. Ngouoto-Nkili, A.K. Bendt, R. Krämer, A.
Burkovski // Mol Microbiol. – 2001. – Vol. 42. – P. 1281-1295.
92. Osanai, T. Identification of PamA as a PII-binding membrane protein important
in nitrogen-related and sugar-catabolic gene expression in Synechocystis sp. PCC
6803 / T. Osanai, S. Sato, S. Tabata, K. Tanaka // Biol Chem. – 2005. – Vol. 280.
– P. 34684-34690.
119
93. Osanai, T. Keeping in touch with PII: PII interacting proteins in unicellular
cyanobacteria / T. Osanai and K. Tanaka // Plant Cell Physiol. – 2007. – Vol. 48.
– P. 908-914.
94. Palinska, K.A. The signal transducer PII and bicarbonate aquisition in
Prochlorococcus marinus PCC 9511, a marine cyanobacterium naturally
deficient in nitrate and nitrite assimilation / K.A. Palinska, W. Laloui, S. Bedu, S.
Loiseaux-de Goer, A.M. Castets, R. Rippka, N. Tandeau de Marsac // Microbiol.
– 2002. – Vol. 148. – P. 2405-2412.
95. Pan, J.M. Characterization of blue light signal transduction chains that control
development and maintenance of sexual competence in Chlamydomonas
reinhardtii / J.M. Pan, M.A. Haring, C.F. Beck // Plant Physiol. – 1997. – Vol.
115. – P. 1241-1249.
96. Pedro-Roig, L. Haloferax mediterranei GlnK proteins are post-translationally
modified by uridylylation / L. Pedro-Roig, M. Camacho, M.J. Bonete (2013a)
Proteomics. – 2013a. –Vol. 13. – P. 1371-1374.
97. Pedro-Roig, L. Nitrogen regulation of protein-protein interactions and transcript
levels of GlnK PII regulator and AmtB ammonium transporter homologs in
Archaea / L. Pedro-Roig, C. Lange, M.J. Bonete, J. Soppa, J. Maupin-Furlow //
Microbiol open. – 2013в. – Vol. 2. – № 5. – P. 826-840.
98. Pedro-Roig, L. Regulation of ammonium assimilation in Haloferax mediterranei:
interaction between glutamine synthetase and two GlnK proteins / L. Pedro-Roig,
M. Camacho, M.J. Bonete // Biochim Biophys Acta. – 2013б. – Vol. 1834. – P.
16-23.
99. Pioszak, A.A. The Escherichia coli PII signal transduction protein regulates the
activities of the two-component system transmitter protein NRPII by direct
interaction with the kinase domain of the transmitter module / A.A. Pioszak, P.
Jiang, A.J. Ninfa // Biochem. – 2000. – Vol. 39. – P. 13450-13461.
120
100. Popov, N. [Reliable micromethod for determination of the protein content in
tissue homogenates] / N. Popov, M. Schmitt, S. Schulzeck, H. Matthies // Acta
Biol Med Ger. –1975. – Vol. 34. – P. 1441-1446.
101. Reitzer, L. Nitrogen assimilation and global regulation in Escherichia coli / L.
Reitzer // Annu Rev Microbiol. – 2003. – Vol. 57. – P. 155-176.
102. Riens, B. Amino acid and sucrose content determined in the cytosolic,
chloroplastic, and vacuolar compartments and in the phloem sap of spinach leaves
/ B. Riens, G. Lohaus, D. Heineke, H.W. Heldt // Plant Phys. – 1991. – Vol. 97. –
P. 227-233.
103. Rodrigues, T.E. Search for novel targets of the PII signal transduction protein in
Bacteria identifies the BCCP component of acetyl-CoA carboxylase as a PII
binding partner / T.E. Rodrigues, E.C. Gerhardt, M.A. Oliveira, L.S. Chubatsu,
F.O. Pedrosa, E.M. Souza, G.A. Souza, M. Müller-Santos, L.F. Huergo // Mol
Microbiol. – 2014. – Vol. 91. – P. 751-761.
104. Sakaguchi, S. A new method for the colorimetric determination of arginine / S.
Sakaguchi // J Biochem. – 1950. – Vol. 37. – P. 231-236.
105. Sakai, H. Crystal structures of the signal transducing protein GlnK from Thermus
thermophilus Hb8 // H. Sakai, H. Wang, C. Takemoto-Hori, T. Kaminishi, H.
Yamaguchi, Y. Kamewari, T. Terada, S. Kuramitsu, M. Shirouzu, S. Yokoyama
// Struct Biol. – 2005. – Vol. 149. – P. 99-110.
106. Sanders, C.E. In vivo phosphorylation of proteins in the cyanobacterium
Synechococcus 6301 after chromatic acclimation to Photosystem I or
Photosystem II light / C.E. Sanders, A. Melis, J.F. Allen // Biochim Biophys
Acta. – 1989. – Vol. 976. – P. 168-172.
107. Sant'Anna, F.H. The PII superfamily revised: a novel group and evolutionary
insights / F.H. Sant'Anna, D.B. Trentini, S. de Souto Weber, R. Cecagno, S.C. da
Silva, I.S. Schrank // Mol Evol. – 2009. – Vol. 68. – P. 322-336.
108. Shapiro, B.M. Glutamine synthetase (Escherichia coli) / B.M. Shapiro and E.R.
Stadtman // Methods Enzymol. – 1970. – Vol. 17A. – P. 910-922.
121
109. Shapiro, B.M. The glutamine synthetase deadenylylating enzyme system from
Escherichia coli: resolution into two components, specific nucleotide stimulation,
and cofactor requirements / B.M. Shapiro // Biochem. – 1969. – Vol. 8. – P. 659670.
110. Shetty, N.D. Crystal structures of the apo and ATP bound Mycobacterium
tuberculosis nitrogen regulatory PII protein / N.D. Shetty, M.C. Reddy, S.K.
Palaninathan, J.L. Owen, J.C. Sacchettini // Protein Sci. – 2010. – Vol. 19. – P.
1513e24
111. Smith, C.S. Lack of evidence for phosphorylation of Arabidopsis thaliana PII:
implications for plastid carbon and nitrogen signaling / C.S. Smith, N.A. Morrice,
G.B. Moorhead // Biochim Biophys Acta. – 2004. – Vol. 1699. – P. 145-154.
112. Smith,
C.S.
Molecular
properties
of
the
putative
nitrogen
sensor PII from Arabidopsis thaliana / C.S. Smith, A.M. Weljie, G.B. Moorhead
//
Plant J. – 2003. – Vol. 33. – № 2. – P. 353-360.
113. Strösser, J. Regulation of GlnK activity: Modification, membrane sequestration,
and proteolysis as regulatory principles in the network of nitrogen control in
Corynebacterium glutamicum / J. Strösser, A. Lüdke, S. Schaffer, R. Krämer, A.
Burkovski // Mol Microbiol. – 2004. – Vol. 54. – P. 132-147.
114. Sugiyama, K. Interaction of N-acetyl glutamate kinase with a PII-like protein in
rice / K. Sugiyama, T. Hayakawa, T. Kudo, T. Ito, T. Yamaya // Plant and Cell
Physiol. – 2004. – Vol. 45. – P. 1768-1778.
115. Takatani, N. Regulation of nitrate reductase by nonmodifiable derivatives of PII
in the cells of Synechococcus elongatus strain PCC 7942 / N. Takatani, M.
Kobayashi, S. Maeda, T. Omata // Plant Cell Physiol. – 2006. – Vol. 47. – P.
1182-1186.
116. Uhrig, G. PII in higher plants: a modern role for an ancient protein / G. Uhrig,
K.K. Ng, G.B. Moorhead // Trends Plant Sci. – 2009. – Vol. 14. – P. 505-511.
122
117. Van Etten, J.L. Virus infection of culturable chlorella-like algae and development
of a plaque assay / J.L. van Etten, D.E. Burbank, D. Kuczmarski, R.H. Meints //
Science. –1983. – Vol. 219. – P. 994-996.
118. Van Heeswijk, W.C. The Escherichia coli signal transducers PII (GlnB) and
GlnK form heterotrimers in vivo: Fine tuning of the nitrogen signal cascade /
W.C. van Heeswijk, D. Wen, P. Clancy, R. Jaggi, D.L. Ollis, H.V. Westerhoff,
S.G. Vasudevan // Proc Natl Acad Sci USA. – 2000. –Vol. 97. – P. 3942-3947.
119. Williams, K.J. Adenylylation of mycobacterial Glnk (PII) protein is induced by
nitrogen limitation / K.J. Williams, M.H. Bennett, G.R. Barton, V.A. Jenkins,
B.D. Robertson // Tuberculosis (Edinb). – 2013. – Vol. 93. – № 2. – P. 198-206.
120. Winter, H. Subcellular volumes and metabolite concentrations in barley leaves /
H. Winter, D.G. Robinson, H.W. Heldt // Planta. – 1993. – Vol. 191. – P. 180190.
121. Winter, H. Subcellular volumes and metabolite concentrations in spinach leaves.
H. Winter, D.G. Robinson, H.W. Heldt // Planta. – 1994. – Vol. 193. – P. 530535.
122. Wray, L. The nitrogen-regulated Bacillus subtilis nrgAB operon encodes a
membrane protein and a protein highly similar to the Escherichia coli glnBencoded PII / L. Wray, M. Atkinson, S. Fisher // Bacteriol. – 1994. – Vol. 176. –
P. 108-114.
123. Wray, L.V.Jr. Bacillus subtilis glutamine synthetase controls gene expression
through a protein-protein interaction with transcription factor TnrA / L.V. Wray
Jr., J.M. Zalieckas, S.H. Fisher // Cell. – 2001. – Vol. 107. – P. 427-435.
124. Xu, Y. GlnK, a PII-homologue: structure reveals ATP binding site and indicates
how the T-loops may be involve in molecular recognition / Y. Xu, E. Cheah, P.D.
Carr, W.C. van Heeswijk, H.V. Westerhoff, S.G. Vasudevan, D.L. Ollis // Mol
Biol. – 1998. – Vol. 282. – P. 149-165.
123
125. Yildiz, Ö. Structure of GlnK1 with bound effectors indicates regulatory
mechanism for ammonia uptake / Ö. Yildiz, C. Kalthoff, S. Raunser, W.
Kühlbrandt // EMBO. – 2007. – Vol. 26. – P. 589-599.
126. Zhang, Y. Functional characterization of three GlnB homologs in the
photosynthetic bacterium Rhodospirillum rubrum: roles in sensing ammonium
and energy status / Y. Zhang, E.L. Pohlmann, P.W. Ludden and G.P. Roberts // J
Bacteriol. – 2001. – Vol. 183. – P. 6159-6168.
ЗАРЕГИСТРИРУЙТЕСЬ - ЭТО БЕСПЛАТНО

Похожие документы